| Sequence 1: | NP_728468.1 | Gene: | Cda4 / 33144 | FlyBaseID: | FBgn0052499 | Length: | 486 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_998378.1 | Gene: | chia.3 / 406819 | ZFINID: | ZDB-GENE-040426-2891 | Length: | 471 | Species: | Danio rerio |
| Alignment Length: | 41 | Identity: | 14/41 - (34%) |
|---|---|---|---|
| Similarity: | 22/41 - (53%) | Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 NGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTF 74 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cda4 | NP_728468.1 | CBM_14 | 33..80 | CDD:426342 | 14/41 (34%) |
| CE4_CDA_like_1 | 130..396 | CDD:200596 | |||
| chia.3 | NP_998378.1 | GH18_chitolectin_chitotriosidase | 25..385 | CDD:119351 | |
| ChtBD2 | 421..469 | CDD:214696 | 14/41 (34%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||