DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and chia.3

DIOPT Version :10

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_998378.1 Gene:chia.3 / 406819 ZFINID:ZDB-GENE-040426-2891 Length:471 Species:Danio rerio


Alignment Length:41 Identity:14/41 - (34%)
Similarity:22/41 - (53%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTF 74
            :|.||.|....::|.|..|:.::.:|..|..|||..|.|.:
Zfish   428 DGLYAHPNDPNKYYSCAGGHTFVEKCAVGTVFDDSCKCCVW 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:426342 14/41 (34%)
CE4_CDA_like_1 130..396 CDD:200596
chia.3NP_998378.1 GH18_chitolectin_chitotriosidase 25..385 CDD:119351
ChtBD2 421..469 CDD:214696 14/41 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.