DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and chia.2

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_998414.1 Gene:chia.2 / 406338 ZFINID:ZDB-GENE-040426-2014 Length:470 Species:Danio rerio


Alignment Length:346 Identity:74/346 - (21%)
Similarity:106/346 - (30%) Gaps:119/346 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 SISQQQGLQDKGYEEWVGEMIGMREILRH--FANVSVNDVVGMRAPFLKPGRNTQ-YKVLEDFG- 255
            ::|..:|..|.|||        :.||.::  |.|:...|..|....|  .|.|:. |:..:|.| 
Zfish   183 AVSAGKGTIDDGYE--------IAEIAKYLDFINIMTYDFHGTWERF--TGHNSPLYQGSKDEGD 237

  Fly   256 YIYDSSITVPPVPVPVWPYTLDYKISHECKSGTCP-----------SRTF-----------PGVW 298
            .:|               :..||.:.:...:|| |           .|||           |...
Zfish   238 LVY---------------FNTDYAMRYWRDNGT-PVEKLRMGFATYGRTFRLTSSDTSVGAPASG 286

  Fly   299 EVPLNTHYVEGYEGGHCPYLDQCVLHNLDEEEVFQWLQEDFSRYYEQNKAPYMMPFHTNW--FQT 361
            .....|:   ..|.|...|.:.|   ...|....||:        :..|.||... ::.|  |.|
Zfish   287 PASAGTY---TREAGFWSYYEIC---GFLEGTTVQWI--------DDQKVPYATK-NSEWVGFDT 336

  Fly   362 KPLENGLHKFLD---------WALELPDVYILTVTQMLQYVTDP--KELRDVSQIESWKCDKSVS 415
            |.......::|.         |||:|.|.    ..|.......|  ..||::..||       :.
Zfish   337 KESYETKVRYLKDKKFGGAFVWALDLDDF----AGQFCGQGNHPLMGHLRNLLDIE-------LP 390

  Fly   416 VAPKPCNIWQTCALPFKI---PEQNLTDTRYMETCREC------------PNVYPWLGDAGGTGI 465
            ..|.|     |.|.|.:.   |....|.|.:......|            ||.|        ...
Zfish   391 PLPPP-----TTAKPGQSTTRPTTTTTTTTHAPGPGFCNGKPDGLYAHPDPNKY--------YSC 442

  Fly   466 AGRDNYIFAGGENPEEEDSAK 486
            ||...|:...|...|.::|.|
Zfish   443 AGGQTYVDNCGAGTEFDESCK 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 50/237 (21%)
chia.2NP_998414.1 GH18_chitolectin_chitotriosidase 23..385 CDD:119351 53/246 (22%)
Glyco_18 24..363 CDD:214753 47/220 (21%)
CBM_14 423..468 CDD:279884 11/49 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.