DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Cht7

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster


Alignment Length:118 Identity:30/118 - (25%)
Similarity:45/118 - (38%) Gaps:33/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QCLVGVLLVITGANGQGKEKE---EFQCP--SHIANGNYA--DP------------------ATC 43
            :|..|...::|..|.:.|:.:   |:..|  ||...|.|.  ||                  |.|
  Fly   903 RCGSGKYPLLTALNDELKDYKVELEYDGPYESHGPRGAYTTKDPHDVTCAEEDGHISYHKDWADC 967

  Fly    44 RRFYQCVDGYPYLNRCPSGLFFDDVQKFCTFKDEAK-CGPLPTTPAPATEAPA 95
            ..:|.|.....:...||:.|.|:..:..|.:.:..: |    .||   |||||
  Fly   968 THYYMCEGERKHHMPCPANLVFNPQENVCDWPENVEGC----HTP---TEAPA 1013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884 13/67 (19%)
CE4_CDA_like_1 130..396 CDD:200596
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 4/15 (27%)
CBM_14 951..1005 CDD:279884 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.