powered by:
Protein Alignment Cda4 and Cht8
DIOPT Version :9
Sequence 1: | NP_728468.1 |
Gene: | Cda4 / 33144 |
FlyBaseID: | FBgn0052499 |
Length: | 486 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611542.2 |
Gene: | Cht8 / 37390 |
FlyBaseID: | FBgn0034580 |
Length: | 476 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 24/68 - (35%) |
Similarity: | 31/68 - (45%) |
Gaps: | 0/68 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 ITGANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTFKDE 77
:|..:.:....|.|.||:....|...||..|.:||.|..|..:...|||||.||...|.|.:...
Fly 409 LTTESNRESPSEGFSCPADAPAGYIRDPDNCSKFYYCSGGKTHNFDCPSGLNFDLDTKSCNYSGS 473
Fly 78 AKC 80
.||
Fly 474 VKC 476
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45463787 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.