DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Cht8

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster


Alignment Length:68 Identity:24/68 - (35%)
Similarity:31/68 - (45%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITGANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTFKDE 77
            :|..:.:....|.|.||:....|...||..|.:||.|..|..:...|||||.||...|.|.:...
  Fly   409 LTTESNRESPSEGFSCPADAPAGYIRDPDNCSKFYYCSGGKTHNFDCPSGLNFDLDTKSCNYSGS 473

  Fly    78 AKC 80
            .||
  Fly   474 VKC 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884 17/46 (37%)
CE4_CDA_like_1 130..396 CDD:200596
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351
Glyco_18 31..379 CDD:214753
CBM_14 424..476 CDD:279884 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.