DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and ChLD3

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_609806.1 Gene:ChLD3 / 35002 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster


Alignment Length:473 Identity:170/473 - (35%)
Similarity:251/473 - (53%) Gaps:61/473 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTFKDEA-KCGPLPTTPAPA---------------- 90
            |.:::.|:||..:..:|..||.||.|::.|.||... .|.....||||.                
  Fly   111 CAKYFLCLDGEVFEFKCSEGLLFDVVRQICDFKANVDNCDVSAETPAPKPLLEMADCADEYQLGC 175

  Fly    91 ----------------------------TEAPADTAQRCNTENCALPYCFCSKDGTQIPGDLEPE 127
                                        .|...:.|..|:...|.||.||||||||||||.|..:
  Fly   176 ADGTCLPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRKCHLPQCFCSKDGTQIPGSLPAQ 240

  Fly   128 KIPQIIMLTFDGAVNLNNYQHYQKI-FDGKRKNPNGCLIRGTFFMSHEYSNYQQIQHLGYYGHEI 191
            .:||:|:||||.|:|.:|::.:.|: |...|:|||||.|:|||::||.::|||.:|.|...||||
  Fly   241 SVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPNGCPIKGTFYVSHPFTNYQYVQKLWNDGHEI 305

  Fly   192 GTESIS----QQQGLQDKGYEEWVGEMIGMREILRHFANVSVNDVVGMRAPFLKPGRNTQYKVLE 252
            ...|::    :....::...|:|..||:|...|:..||.|.:.::.|||.|||:.|.|.|:.:::
  Fly   306 AVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAVRMEEIRGMRVPFLRVGWNRQFLMMK 370

  Fly   253 DFGYIYDSSITVPPVPVPVWPYTLDYKISHECK--SGTCPSRTFPGVWEVPLNTHYVEGYEGGHC 315
            :||::||||:..|....|:||||||||:.|.|.  :..||||::||:||:.:|...|..|   .|
  Fly   371 EFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGVNQNCPSRSYPGIWELVMNQLEVGEY---MC 432

  Fly   316 PYLDQCVLHNLDEEEVFQWLQEDFSRYYEQNKAPYMMPFHTNWFQTKPLENGLHKFLDWALELPD 380
            ..:|.|..| |..|:|::.|..:|.|:|..|:||:.:.||:.||:.....|...||||...:|||
  Fly   433 GMVDTCPPH-LSGEDVYRMLTHNFKRHYLSNRAPFGLYFHSTWFKKVDYLNAFLKFLDDLQKLPD 496

  Fly   381 VYILTVTQMLQYVTDPKELRDVSQIESWKCD-KSVSVAPKPCNIWQTCALPFKIPEQNLTDTRYM 444
            |:.:|..|.:|::..|.....:.|.|||.|. |.:....:.||....|    |:..:.|.:.|:.
  Fly   497 VFFVTNQQAIQWMRHPTPSNQLHQFESWHCQPKDLDPHEQVCNTPNVC----KVRSRVLQEDRFF 557

  Fly   445 ETCRECPNVYPWLGDAGG 462
            .||.|||..|||:.:..|
  Fly   558 YTCMECPAQYPWIRNEFG 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884 13/37 (35%)
CE4_CDA_like_1 130..396 CDD:200596 111/272 (41%)
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884 13/37 (35%)
LDLa 168..202 CDD:238060 0/33 (0%)
CE4_CDA_like_1 243..512 CDD:200596 111/272 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060206at2759
OrthoFinder 1 1.000 - - FOG0003270
OrthoInspector 1 1.000 - - otm14253
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4295
66.020

Return to query results.
Submit another query.