DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Idgf3

DIOPT Version :10

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_477256.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster


Alignment Length:183 Identity:37/183 - (20%)
Similarity:59/183 - (32%) Gaps:72/183 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CFCSKDGTQIPGDLEPEKIPQIIMLTFD-------------GAVNLNNYQ-------------HY 149
            ||....|:|..|      :.|..|:..:             ..||.:||:             |.
  Fly    29 CFYDSQGSQRQG------LAQFSMIDIELALQFCTHLVYGYAGVNADNYEMQSINKRLDLEQRHL 87

  Fly   150 QKIFDGKRKNPNGCLIRGTFFMS-------HEYSNYQQIQHLGYYGHEIGTESISQQQGLQDKGY 207
            .:|...|.:.|:   |:  |.:|       :|.:.|.::...|..||....||            
  Fly    88 AQITSMKERYPH---IK--FLLSVGGDADTYEGNQYIKLLESGQQGHRRFIES------------ 135

  Fly   208 EEWVGEMIGMREILRHFANVSVNDVVGMRAPFLKPGRNTQYKVLEDFGYIYDS 260
                     .|:::|.: |....|:.      |:..||...||..|.|..:.|
  Fly   136 ---------ARDLVRRY-NFDGLDLA------LQLPRNKPRKVHGDVGSAWKS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:426342
CE4_CDA_like_1 130..396 CDD:200596 32/164 (20%)
Idgf3NP_477256.1 GH18_IDGF 26..440 CDD:119352 37/183 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.