DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Idgf2

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster


Alignment Length:106 Identity:27/106 - (25%)
Similarity:38/106 - (35%) Gaps:44/106 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 YVTDP-----KE-----LRDVSQIESWKCD---KSVSVAPKPCNIWQTCALPFKIPEQN-LTDTR 442
            ::.||     ||     :|||.  :|.:.|   .|::|.|...:.|.     |.||..| |.|..
  Fly   180 FIVDPHAALHKEQFTALVRDVK--DSLRADGFLLSLTVLPNVNSTWY-----FDIPALNGLVDFV 237

  Fly   443 YMETCRECPNVYPWLGDAGGTGIAGRDNYIFAGGENPEEED 483
            .:.|       :.:|..|                .||||.|
  Fly   238 NLAT-------FDFLTPA----------------RNPEEAD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 0/3 (0%)
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 27/106 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.