DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and chia.6

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_955897.2 Gene:chia.6 / 322420 ZFINID:ZDB-GENE-030131-1140 Length:480 Species:Danio rerio


Alignment Length:360 Identity:68/360 - (18%)
Similarity:110/360 - (30%) Gaps:129/360 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 GTQIPGDLEPEKIPQIIMLTFDGAVNLNNYQHYQ-------KIFDG-KRKNPN-------GCLIR 166
            |..:|.:::|.....:| ..|....|.|....|:       :.|:| |:.|||       |....
Zfish    38 GKYMPSNVDPHLCTHLI-YAFSIINNENKLTTYEWNDETLYQSFNGLKQSNPNLKTLLAVGGWNF 101

  Fly   167 GTFFMSHEYSNYQQIQHL-----------GYYGHEIG---------------------------- 192
            ||...|...|..|..|..           |:.|.::.                            
Zfish   102 GTTQFSSMVSTPQNRQTFIQSSITFLRTHGFDGLDLDWEYPGSRGSPPEDKQRFTLLCKELVEAY 166

  Fly   193 --------------TESISQQQGLQDKGYEEWVGEMIGMREILRH--FANVSVND-------VVG 234
                          |.:::..:|..|.|||        :.||.::  |.|:...|       |.|
Zfish   167 QAESAATGRPRLMLTAAVAAGKGNIDAGYE--------IAEIAKYLDFINIMTYDFHGSWESVTG 223

  Fly   235 MRAPFLKPGRNTQYKVL--EDFGYIY--DSSITVPPVPVPVWPYTLDYKISHECK------SGTC 289
            ..:|..:...:...|:.  .||...|  |....|..:.:....|...:::|....      ||..
Zfish   224 HNSPLYRGSGDIGDKIYYNTDFAMTYWRDQGAPVEKLRMGFAAYGRTFRLSSAVSGVGAPASGAA 288

  Fly   290 PSRTF---PGVWEVPLNTHYVEGYEGGHCPYLDQCVLHNLDEEEV------FQWLQEDFSRYYEQ 345
            .:.|:   .|.|..         ||  .|.:|.|..:..:.:::|      .:|:..|....| :
Zfish   289 SAGTYTREAGFWSY---------YE--ICTFLKQATVQQIVDQKVPYATKGQEWVGFDNMESY-K 341

  Fly   346 NKAPYMMPFHTNWFQTKPLENGLHKFLDWALELPD 380
            .|..|:.            |.|......|||:|.|
Zfish   342 TKVDYLK------------EKGFGGAFVWALDLDD 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 65/347 (19%)
chia.6NP_955897.2 Glyco_18 22..363 CDD:214753 66/357 (18%)
GH18_chitolectin_chitotriosidase 23..385 CDD:119351 68/360 (19%)
CBM_14 433..479 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.