DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Chit1

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001073157.1 Gene:Chit1 / 289032 RGDID:1305646 Length:464 Species:Rattus norvegicus


Alignment Length:56 Identity:20/56 - (35%)
Similarity:25/56 - (44%) Gaps:11/56 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTF 74
            |||           |:|.|.:|.....||.|..|..:.:.||.||.|.|..|.||:
  Rat   419 QGK-----------ADGLYPNPTEKSSFYSCGGGRLFQHSCPPGLVFIDSCKCCTW 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884 17/42 (40%)
CE4_CDA_like_1 130..396 CDD:200596
Chit1NP_001073157.1 GH18_chitolectin_chitotriosidase 24..383 CDD:119351
ChtBD2 416..463 CDD:214696 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.