DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Chil6

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_017175043.1 Gene:Chil6 / 229688 MGIID:2682303 Length:452 Species:Mus musculus


Alignment Length:297 Identity:56/297 - (18%)
Similarity:103/297 - (34%) Gaps:94/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PGDLEPEKIPQIIMLTFDGAVNL----------------NNY-QHYQKIFDGKRKNPNGCLIRGT 168
            ||.:....|.:::.:.   .:||                ||: ||...:.|.|.::.:.||    
Mouse    10 PGSVLKATISKLVFIM---GLNLLLNAQMGSAYQLMCYFNNWPQHQPDVRDIKHEDIDPCL---- 67

  Fly   169 FFMSHEYSNYQQIQHLGYYGHEIGTESISQQQGLQD-KGYEEWVGEMIGMREILRHFANVSVNDV 232
              .:|...::..|....:        ::::::.|.| ||:.:     :..|:.|..|.:.|.   
Mouse    68 --CTHLIYSFAGIWENNF--------TMTKRKELDDYKGFND-----LKKRQHLWRFIHASF--- 114

  Fly   233 VGMRAPFLKPGRNTQYKVLEDFG---YIYDSSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTF 294
                       ||.:.|.|...|   :...|.||:...|.....:.... |....|.|      |
Mouse   115 -----------RNNKLKTLLSIGCWNFGDGSFITMVSTPENRHSFITSI-IKFLRKYG------F 161

  Fly   295 PGV---WEVPLNTHYVEGYEGGHCPYLDQCVLHNLDEEEVFQWLQEDFSRYYEQNKAPYMMPFHT 356
            .|:   |:.|       |..|.  |..|:.:...|..|     :::.|.:...:||.|.:|    
Mouse   162 DGLNLAWQYP-------GCYGS--PPRDKHLFTILMHE-----IRKAFEKEVSKNKKPRLM---- 208

  Fly   357 NWFQTKPLENGLHKFLDWALELPDVYILTVTQMLQYV 393
                ......|:...:.:..|:|.     ::|.|.|:
Mouse   209 ----VTAAVAGVISTIQFGYEIPQ-----LSQSLDYI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 53/288 (18%)
Chil6XP_017175043.1 GH18_chitolectin_chitotriosidase 41..416 CDD:119351 51/263 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846825
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.