DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and chil-18

DIOPT Version :10

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_496024.2 Gene:chil-18 / 187735 WormBaseID:WBGene00011161 Length:429 Species:Caenorhabditis elegans


Alignment Length:176 Identity:30/176 - (17%)
Similarity:61/176 - (34%) Gaps:45/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 YEEWVGEM--------IGMREILRHFANVSVNDVVGMRAPFLKPGRNTQYKVLEDFGYIYDSSIT 263
            |.:|:|..        ..::::......|..:.::.:.||..|..|.......:|| ..|...:.
 Worm   178 YWKWLGNSETEHHDFPSFLKDLKEKLKTVRDDSIISIVAPQAKMDRRHDGYKFDDF-MEYIDFVN 241

  Fly   264 VPPVPVPVWPYTLDYKISHECKSGTCPSRTFPGVWEVPLNTHYVEGYEGGHCPYLDQCVLHNLDE 328
            |         :::||......:.||....:.|....:.:..|:                  |:|.
 Worm   242 V---------FSMDYYGPWPNQWGTPTGPSAPLYGGIGVKKHF------------------NVDS 279

  Fly   329 E-EVFQWLQEDFSRYYEQNKAPYMMPFHTN-WFQTK-PLENGLHKF 371
            . :.:..:.||.|::      ..::||:.. |...| |:.:|...|
 Worm   280 TMKYYTCMTEDPSKF------NMVIPFYVRLWKNVKEPISSGTEVF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:426342
CE4_CDA_like_1 130..396 CDD:200596 30/176 (17%)
chil-18NP_496024.2 Glyco_18 70..401 CDD:214753 30/176 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.