DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and chil-5

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_496127.1 Gene:chil-5 / 182435 WormBaseID:WBGene00007470 Length:459 Species:Caenorhabditis elegans


Alignment Length:429 Identity:71/429 - (16%)
Similarity:128/429 - (29%) Gaps:179/429 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LPTTPAPATEAPADTAQRCNTENCALPYCFCSKDGTQIPGDLEPEKI--PQIIMLTF-------- 137
            |.||  ..|.:|.....:.:.:..:.|..||.|.......:.|...:  .|:.|||.        
 Worm    81 LSTT--TKTNSPPKHLIQESHQTISPPAAFCGKRIVGYFAEFENAGLSRKQLHMLTHIIYLFARP 143

  Fly   138 -DGAVNLNNYQHYQKIFDGKRKNPNGCLIRGTFFMSHEYSNYQQIQHLGYYGHEIGTESISQQQG 201
             :|.:.|:..|..:|..:.|.|             :.|.|:..::. :...||:.          
 Worm   144 TNGVITLDGEQTRRKFEEMKSK-------------AREASSTLKVM-ISVGGHDY---------- 184

  Fly   202 LQDKGYEEW-------VGEMIGMREILRHFANVSVNDVVGMRAPFLKP----------------- 242
                 |:|:       ....:.::.|:..|..   ||:.|:...:.:|                 
 Worm   185 -----YKEYSRLVSNETSRNVFVKSIVSFFKK---NDIDGIEIFWTRPKYEDIKSYSSFIQELRS 241

  Fly   243 ---------GRNTQYKV-------------LEDFG------YIYDSSITVPPV--PVPVW----- 272
                     .|..:|.:             |:||.      .||.:......|  ..|::     
 Worm   242 AFTELQKRWNRKNEYIISLIVPKEKHWSFDLKDFSKFVDFFNIYSTQFREKQVGPDSPLYGGEGR 306

  Fly   273 --PYTLDYKISHECKSGTCPSR-----TFPGVWEVPLNTHYVEGYEGGHCPYLDQCVLHNLDEEE 330
              ..|:.|.|   ||:|. ||:     :|.|.:           :||...|..|.       .::
 Worm   307 NIDETMKYYI---CKTGQ-PSKFNIMVSFHGTF-----------WEGAELPLRDY-------SDD 349

  Fly   331 VFQWLQEDFSR---------------------YYEQNKAPYM-MPFHTNWFQTKPLENGLHKFLD 373
            :  |.:::.:|                     ::...|..|: :|....||.|...|..|.    
 Worm   350 I--WKEKNVARGPFAVRWRHLRQRNWNLTDIKFHNLTKTSYIWIPGPPTWFLTLEDEKSLR---- 408

  Fly   374 WALELPDVYILTVTQMLQYVTDPKELRDVSQIESWKCDK 412
                          :..:||.|    .::..|..|..|:
 Worm   409 --------------EKNRYVAD----HNIGGITMWTIDQ 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 57/362 (16%)
chil-5NP_496127.1 Glyco_18 112..430 CDD:214753 62/396 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.