DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and lmd-4

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_504862.2 Gene:lmd-4 / 179121 WormBaseID:WBGene00017233 Length:2011 Species:Caenorhabditis elegans


Alignment Length:231 Identity:50/231 - (21%)
Similarity:78/231 - (33%) Gaps:80/231 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 KGYEEWVGEMIGMREILRH--FANVSVND-----------VVGMRAP-FLKPGRNTQYKVLEDFG 255
            |||:        ::.||::  |.||...|           ..|..|| :....:....|:..||.
 Worm  1653 KGYD--------LKGILKYADFINVMTYDYYGAWESKWGAYTGTPAPLYFGSLKGFSGKLNADFS 1709

  Fly   256 YIYDSSITVPP----VPVP----VWPYTLDYKISHECKSGTCPSRTFPGVWE--VPLNTHYVEGY 310
            ..:.:..|..|    :.||    .|...|.            |......:|.  .|.|..|..||
 Worm  1710 MKFYACKTEKPSQLNMGVPFYGRYWKNVLG------------PIDKSDNMWRTAAPQNGKYEGGY 1762

  Fly   311 EGGHCPYLDQCVLHNLDEEEVFQWLQEDFSRYYEQNKAPYMMPFHTNWFQTKPLENGLHKFLDWA 375
            .|          ..||.:|   .| .:..:.::|:.|.||:|            .||..|||.:.
 Worm  1763 VG----------WRNLAKE---GW-NKGSASWHEKTKTPYIM------------NNGAKKFLGFE 1801

  Fly   376 LELPDVYILTVTQMLQYVTDPKELRDVSQIESWKCD 411
            .|      .::.:.::|.||    |::..:..|..|
 Worm  1802 NE------RSLKEKMKYATD----RNLGGLMIWALD 1827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 46/214 (21%)
lmd-4NP_504862.2 LysM 25..65 CDD:197609
LysM 79..120 CDD:197609
LysM 142..185 CDD:197609
LysM 209..250 CDD:197609
LysM 270..313 CDD:197609
LysM 334..377 CDD:197609
LysM 401..444 CDD:197609
LysM 469..509 CDD:197609
LysM 550..590 CDD:197609
LysM 635..678 CDD:197609
LysM 710..750 CDD:197609
LysM 760..802 CDD:197609
LysM 876..919 CDD:197609
Self-incomp_S1 1359..1433 CDD:283566
Glyco_18 1480..1825 CDD:214753 48/227 (21%)
GH18_chitinase-like 1481..1824 CDD:299167 48/226 (21%)
ChtBD1_GH18_2 1873..1924 CDD:211315
ChtBD1_GH18_2 1951..2002 CDD:211315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.