DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and chil-13

DIOPT Version :10

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_496018.2 Gene:chil-13 / 174500 WormBaseID:WBGene00010945 Length:439 Species:Caenorhabditis elegans


Alignment Length:216 Identity:39/216 - (18%)
Similarity:64/216 - (29%) Gaps:94/216 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 SITVPPVPVPVWP-----------------YTLDYKISHECKSGTCPSRTFPGVWEVPLNTHYVE 308
            |:|||...|..|.                 |::||            :..:|..|.||       
 Worm   223 SMTVPAAGVDNWELGFDLEELQNHVDFFNVYSMDY------------AGPWPNQWGVP------- 268

  Fly   309 GYEGGHCPYLDQCVLHNLDEEEVF--QWLQEDFSRYYEQNKAPYMM----PF------------- 354
              .|...|     :.:|:...:.|  .|..:   .|..:.|.|.|:    ||             
 Worm   269 --TGPSSP-----MFYNIGARKNFYVDWTMK---HYTCKLKQPSMLNMVIPFSARIWNNVQEAID 323

  Fly   355 -HTNWFQTKPLENGL-------------HKFLD-------------WALELPDVYILTV--TQML 390
             .|..|:...|:|.:             |:.|:             :.|:|.....||.  .:.:
 Worm   324 NRTEVFRNAELKNNMAEGRTQISRWTAEHEGLELSPSSWDNLTMTPYILDLKAKTFLTFEDKRSI 388

  Fly   391 QYVTDPKELRDVSQIESWKCD 411
            :..||..:..|:..:..|..|
 Worm   389 KIKTDYAKKMDLGGVWLWSVD 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:426342
CE4_CDA_like_1 130..396 CDD:200596 35/199 (18%)
chil-13NP_496018.2 Glyco_18 81..411 CDD:214753 39/216 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.