powered by:
Protein Alignment Cda4 and T19H5.6
DIOPT Version :9
Sequence 1: | NP_728468.1 |
Gene: | Cda4 / 33144 |
FlyBaseID: | FBgn0052499 |
Length: | 486 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001254213.1 |
Gene: | T19H5.6 / 13186491 |
WormBaseID: | WBGene00044807 |
Length: | 286 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 18/68 - (26%) |
Similarity: | 30/68 - (44%) |
Gaps: | 14/68 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 371 FLDWALELPDVYILTVTQML----------QYVTDPKELRDVSQIESWKCD--KSVSVAPKPCNI 423
|::..|||.:.|.|....:. :|....:||: .|:::.:.| .||.|||...|.
Worm 159 FINAILELLEKYDLDGVDLFWRWPKSDDKDEYAVFLRELK--KQLKARRKDYILSVVVAPLDINR 221
Fly 424 WQT 426
|.:
Worm 222 WDS 224
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160164247 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.