DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Ovgp1

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_031722.1 Gene:Ovgp1 / 12659 MGIID:106661 Length:721 Species:Mus musculus


Alignment Length:109 Identity:25/109 - (22%)
Similarity:39/109 - (35%) Gaps:34/109 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 LKPGRNTQYKVLEDFGYIYDSSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTFPGVWEVP-LN 303
            :|....|.||::..|.....|.    |.|..:.|:.||                       | |.
Mouse    14 MKHSDGTAYKLVCYFTNWAHSR----PGPASIMPHDLD-----------------------PFLC 51

  Fly   304 THYVEGYEGGHCPYLDQCVLHNLDEEEVFQWLQEDFSRYYEQNK 347
            ||.:..:..   ...:|.|..||.:|.|   |..:|::..|:|:
Mouse    52 THLIFAFAS---MSNNQIVAKNLQDENV---LYPEFNKLKERNR 89

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 25/109 (23%)
Ovgp1NP_031722.1 Glyco_18 23..360 CDD:214753 22/100 (22%)
GH18_chitolectin_chitotriosidase 24..382 CDD:119351 21/99 (21%)