Sequence 1: | NP_728468.1 | Gene: | Cda4 / 33144 | FlyBaseID: | FBgn0052499 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034022.2 | Gene: | Chil3 / 12655 | MGIID: | 1330860 | Length: | 398 | Species: | Mus musculus |
Alignment Length: | 243 | Identity: | 49/243 - (20%) |
---|---|---|---|
Similarity: | 80/243 - (32%) | Gaps: | 96/243 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 KDGTQIPGDLEPEKIPQIIMLTFD-----GAVNLNNYQHYQKIFD-GKRKNPN-GCLIRGTFFMS 172
Fly 173 HEYSNYQQIQHLGYYGHE----------IGTESIS--------QQQGL----------------- 202
Fly 203 ----QDKGY----EEWVGEMIGMREILRHFANVSVNDVVGMRAPFLKPGRNTQYKVLEDFGYIYD 259
Fly 260 SSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTFP--GVWEVPLNTH 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cda4 | NP_728468.1 | CBM_14 | 33..80 | CDD:279884 | |
CE4_CDA_like_1 | 130..396 | CDD:200596 | 44/228 (19%) | ||
Chil3 | NP_034022.2 | GH18_chitolectin_chitotriosidase | 24..387 | CDD:119351 | 46/238 (19%) |
Glyco_18 | 26..365 | CDD:214753 | 41/211 (19%) | ||
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 | 70..71 | ||||
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 | 97..100 | ||||
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 | 210..213 | 1/2 (50%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167846823 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |