DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Chil3

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_034022.2 Gene:Chil3 / 12655 MGIID:1330860 Length:398 Species:Mus musculus


Alignment Length:243 Identity:49/243 - (20%)
Similarity:80/243 - (32%) Gaps:96/243 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KDGTQIPGDLEPEKIPQIIMLTFD-----GAVNLNNYQHYQKIFD-GKRKNPN-GCLIRGTFFMS 172
            |.|.:|| :|. :.:..|.::|:|     ......|...|:..:| ||..:.| ..:|  :::..
Mouse   192 KSGYKIP-ELS-QSLDYIQVMTYDLHDPKDGYTGENSPLYKSPYDIGKSADLNVDSII--SYWKD 252

  Fly   173 HEYSNYQQIQHLGYYGHE----------IGTESIS--------QQQGL----------------- 202
            |..::.:.|.....|||.          ||..:||        .:.||                 
Mouse   253 HGAASEKLIVGFPAYGHTFILSDPSKTGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEGATEV 317

  Fly   203 ----QDKGY----EEWVGEMIGMREILRHFANVSVNDVVGMRAPFLKPGRNTQYKVLEDFGYIYD 259
                |:..|    .||||     .:.:|.|.         ::|.:||                 |
Mouse   318 WDAPQEVPYAYQGNEWVG-----YDNVRSFK---------LKAQWLK-----------------D 351

  Fly   260 SSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTFP--GVWEVPLNTH 305
            :::.    ...|||..:|     :.....|..|.||  ...:..||.|
Mouse   352 NNLG----GAVVWPLDMD-----DFSGSFCHQRHFPLTSTLKGDLNIH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 44/228 (19%)
Chil3NP_034022.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 46/238 (19%)
Glyco_18 26..365 CDD:214753 41/211 (19%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 70..71
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 97..100
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 210..213 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.