DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Chia

DIOPT Version :10

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_997469.1 Gene:Chia / 113901 RGDID:1303058 Length:473 Species:Rattus norvegicus


Alignment Length:60 Identity:19/60 - (31%)
Similarity:27/60 - (45%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTF 74
            |::|.|.|...| |... |:|.|........|:.|::|..|...|.:||.||.....|.:
  Rat   415 GSSGGGSEGSGF-CAGK-ADGLYPVADDRNAFWHCINGITYQQHCQAGLVFDTSCNCCNW 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:426342 13/42 (31%)
CE4_CDA_like_1 130..396 CDD:200596
ChiaNP_997469.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..421 2/5 (40%)
ChtBD2 426..473 CDD:214696 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.