DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cda4 and Chia

DIOPT Version :9

Sequence 1:	NP_728468.1	Gene:	Cda4 / 33144	FlyBaseID:	FBgn0052499	Length:	486	Species:	Drosophila melanogaster
Sequence 2:	NP_997469.1	Gene:	Chia / 113901	RGDID:	1303058	Length:	473	Species:	Rattus norvegicus

Alignment Length:	60	Identity:	19/60 - (31%)
Similarity:	27/60 - (45%)	Gaps:	2/60 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 GANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTF 74
            |::|.|.|...| |... |:|.|........|:.|::|..|...|.:||.||.....|.:
  Rat   415 GSSGGGSEGSGF-CAGK-ADGLYPVADDRNAFWHCINGITYQQHCQAGLVFDTSCNCCNW 472

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cda4	NP_728468.1	CBM_14	33..80	CDD:279884	13/42 (31%)
Cda4	NP_728468.1	CE4_CDA_like_1	130..396	CDD:200596
Chia	NP_997469.1	GH18_chitolectin_chitotriosidase	24..387	CDD:119351
		Glyco_18	24..365	CDD:214753
		Chitooligosaccharide binding. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01258	70..71
		Chitooligosaccharide binding. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01258	97..100
		Chitooligosaccharide binding. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01258	210..213
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	395..421		2/5 (40%)
		ChtBD2	426..473	CDD:214696	15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166350350
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930