DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and CHIT1

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_003456.1 Gene:CHIT1 / 1118 HGNCID:1936 Length:466 Species:Homo sapiens


Alignment Length:63 Identity:21/63 - (33%)
Similarity:27/63 - (42%) Gaps:6/63 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQGKEKEEFQCPSH------IANGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTF 74
            ||..|.|....|..      .|:|.|.:|.....||.|..|..:...||:||.|.:..|.||:
Human   403 GQPSEPEHGPSPGQDTFCQGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884 16/42 (38%)
CE4_CDA_like_1 130..396 CDD:200596
CHIT1NP_003456.1 Glyco_18 23..363 CDD:214753
GH18_chitolectin_chitotriosidase 24..385 CDD:119351
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 70..71
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 97..100
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 210..213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..424 5/20 (25%)
ChtBD2 419..466 CDD:214696 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.