DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and CHI3L2

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_003991.2 Gene:CHI3L2 / 1117 HGNCID:1933 Length:390 Species:Homo sapiens


Alignment Length:239 Identity:52/239 - (21%)
Similarity:82/239 - (34%) Gaps:74/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IPGDLEPEKIPQ----IIMLTFDGAVNLNNYQHYQKIFDGKRKNP-----NGCLIRGTFFMSHEY 175
            |....:.||:.:    |.:|:||              |.|..:.|     |..|.:|  :.....
Human   191 IDNSYQVEKLAKDLDFINLLSFD--------------FHGSWEKPLITGHNSPLSKG--WQDRGP 239

  Fly   176 SNYQQIQH-LGYYGHEIGTESISQQQGLQDKGYEEWVGEMIGMREILRHFANVSVNDVVGMRAPF 239
            |:|..::: :||:.|: |..|.....|:...|:.               |...|....||  ||.
Human   240 SSYYNVEYAVGYWIHK-GMPSEKVVMGIPTYGHS---------------FTLASAETTVG--APA 286

  Fly   240 LKPGRNTQYKVLEDFGYI--YD----------SSITVPPVPVPV----WPYTLDYKISHECKSGT 288
            ..||  ....:.|..|::  |:          :.:....||..|    |....|.| |.|.|...
Human   287 SGPG--AAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVK-SMETKVQF 348

  Fly   289 CPSRTFPG--VWEVPLNTHYVEGYEGGHC---PY-LDQCVLHNL 326
            ..:....|  :|.:.:     :.:.|..|   || |.|.|..:|
Human   349 LKNLNLGGAMIWSIDM-----DDFTGKSCNQGPYPLVQAVKRSL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 49/229 (21%)
CHI3L2NP_003991.2 GH18_chitolectin_chitotriosidase 29..387 CDD:119351 51/237 (22%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 75..76
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 102..105
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 210..213 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.