DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17598 and AT5G01700

DIOPT Version :9

Sequence 1:NP_001259780.1 Gene:CG17598 / 33140 FlyBaseID:FBgn0031194 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001031819.1 Gene:AT5G01700 / 831695 AraportID:AT5G01700 Length:382 Species:Arabidopsis thaliana


Alignment Length:414 Identity:92/414 - (22%)
Similarity:144/414 - (34%) Gaps:161/414 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 YFGIFDGHAGYGAALAASHQFHHI-------LHEKLVDCLELLLPRDADATNGGGEGNKLNPTFP 193
            :.|:||||...|..::     .|:       :|.|:           ..:.:.|.|..:.|.:..
plant    78 FCGVFDGHGPMGHKIS-----RHVCENLPSRVHSKI-----------RSSKSAGDENIENNSSQS 126

  Fly   194 HPIYFQRRVTKDELIIGALESAFFNMDSLIAQDCDRYRDAGGCTACVSLFIDGK-MYVANAGDSR 257
            ....|  |..:|.|:     :.|..:||.:..|........|.|| |::|.... :.:||.|.||
plant   127 QEELF--REFEDILV-----TFFKQIDSELGLDSPYDSFCSGTTA-VTVFKQADCLVIANLGHSR 183

  Fly   258 AVLCQRRATPERPQTNTDSGIEPDPLEASCYPVPFSADHTP--ETERERLLNVARLKPHLMGKHY 320
            |||..|.                   :.|...|..:.|..|  :.|.||:::       ..|:.:
plant   184 AVLGTRS-------------------KNSFKAVQLTVDLKPCVQREAERIVS-------CKGRVF 222

  Fly   321 VAMEYAKRPHIKDMGQRILCRQGTMRGWTYKTLTMEDLCMPVVNGEGKRSRLLGTLGVTRGFG-- 383
             |||  :.|.:                  |:....:|.|              ..|.::|.||  
plant   223 -AME--EEPDV------------------YRVWMPDDDC--------------PGLAMSRAFGDF 252

  Fly   384 ---DHELLAINTGIQIKPFLTPHPDVRQRDLTQVVSIPDEDNRDGDYGVLVMATDGLWDVSENDA 445
               |:.|:.|             |||    ..:.||..||        .:|:||||:|||..|:.
plant   253 CLKDYGLVCI-------------PDV----FCRKVSREDE--------FVVLATDGIWDVLSNEE 292

  Fly   446 VSRTVFQTLSKYSTEKHRYTMVAQELVARARGKINDSGHWRLADSKAAATVDDISVIVIPVCQYY 510
            |.:.|       .:.|.| ::.|:.||.||      :..||  ....|:..||.:|:|:     |
plant   293 VVKVV-------GSCKDR-SVAAEMLVQRA------ARTWR--TKFPASKADDCAVVVL-----Y 336

  Fly   511 KEH---------------VEWTQN 519
            ..|               :.|..|
plant   337 LNHRPYPREGNVSRAISTISWRSN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17598NP_001259780.1 PP2Cc 98..506 CDD:238083 88/384 (23%)
AT5G01700NP_001031819.1 PP2Cc 47..337 CDD:238083 88/389 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.