DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17598 and AT4G31860

DIOPT Version :9

Sequence 1:NP_001259780.1 Gene:CG17598 / 33140 FlyBaseID:FBgn0031194 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_194914.1 Gene:AT4G31860 / 829315 AraportID:AT4G31860 Length:357 Species:Arabidopsis thaliana


Alignment Length:402 Identity:76/402 - (18%)
Similarity:126/402 - (31%) Gaps:190/402 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 TYFGIFDGHAGYGAALAASHQFHHILHEKLVD--CLELLLPRDADATNGGGEGNKLNPTFPHPIY 197
            ::.|::|||.|                 |:|.  |.:                           |
plant    51 SFLGVYDGHGG-----------------KVVSKFCAK---------------------------Y 71

  Fly   198 FQRRVTKDELI----IG-ALESAFFNMDSLI-------------------------------AQD 226
            ..::|..||..    :| :|:.|||.||.::                               :.|
plant    72 LHQQVLSDEAYAAGDVGTSLQKAFFRMDEMMQGQRGWRELAVLGDKINKFSGMIEGLIWSPRSGD 136

  Fly   227 CDRYRDA---------------GGCTACVSLFIDGKMYVANAGDSRAVLCQRRATPERPQTNTDS 276
            .....||               .|.||||::..|.:::||||||||.|:.::.            
plant   137 SANKPDAWAFEEGPHSDFAGPNSGSTACVAVVRDKQLFVANAGDSRCVISRKN------------ 189

  Fly   277 GIEPDPLEASCYPVPFSADHTPETERERLLNVARLKPHLMGKHYVAMEYAKRPHIKDMGQRILCR 341
                     ..|.:  |.||.|:.|.|:                               :|||..
plant   190 ---------QAYNL--SRDHKPDLEAEK-------------------------------ERILKA 212

  Fly   342 QGTMRGWTYKTLTMEDLCMPVVNGEGKRSRLLGTLGVTRGFGDHELLAINTGIQIKPFLTPHPDV 406
            .|.:..                      .|:.|:|.::|..||.|..........|..:|..|||
plant   213 GGFIHA----------------------GRVNGSLNLSRAIGDMEFKQNKFLPSEKQIVTASPDV 255

  Fly   407 RQRDLTQVVSIPDEDNRDGDYGVLVMATDGLWDVSENDAVSRTVFQTLSKYSTEKHRYTMVAQEL 471
                  ..|.:.|:|:      .||:|.||:||...:..:...:.:.|:    .:.:.::|.:::
plant   256 ------NTVELCDDDD------FLVLACDGIWDCMTSQQLVDFIHEQLN----SETKLSVVCEKV 304

  Fly   472 VARARGKINDSG 483
            :.|.... |.||
plant   305 LDRCLAP-NTSG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17598NP_001259780.1 PP2Cc 98..506 CDD:238083 76/402 (19%)
AT4G31860NP_194914.1 PP2Cc 23..329 CDD:238083 76/402 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.