DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17598 and PLL1

DIOPT Version :9

Sequence 1:NP_001259780.1 Gene:CG17598 / 33140 FlyBaseID:FBgn0031194 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_181078.2 Gene:PLL1 / 818102 AraportID:AT2G35350 Length:783 Species:Arabidopsis thaliana


Alignment Length:352 Identity:82/352 - (23%)
Similarity:120/352 - (34%) Gaps:124/352 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ELIIGAL-------ESAFFNMDSLIAQDCDRYRDAGGCTACVSLFIDGKMYVANAGDSRAVLCQ- 262
            ||::.|:       |.||..|...:.:........|.| ..|:|..|..:|:.|.|||||::.| 
plant   488 ELVLKAMSNGLEATEQAFLEMTDKVLETNPELALMGSC-LLVALMRDDDVYIMNIGDSRALVAQY 551

  Fly   263 ------------RRATPERPQTNTDSGIEPDPL-----------EASCYPVP--------FSADH 296
                        .|....|...:.|.| ..:||           ||   |:|        .:.||
plant   552 QVEETGESVETAERVEERRNDLDRDDG-NKEPLVVDSSDSTVNNEA---PLPQTKLVALQLTTDH 612

  Fly   297 TPETERERLLNVARLKPHLMGKHYVAMEYAKRPHIKDMGQRILCRQGTMRGWTYKTLTMEDLCMP 361
            :...|.|    |.|:               |..|..|                       :.|  
plant   613 STSIEDE----VTRI---------------KNEHPDD-----------------------NHC-- 633

  Fly   362 VVNGEGKRSRLLGTLGVTRGFG---------DHELLAI--NTGIQIKPFLTPHPDVRQRDLTQVV 415
            :||     .|:.|.|.|||.||         :..||.:  |..|...|:::..|.:|...||   
plant   634 IVN-----DRVKGRLKVTRAFGAGFLKQPKLNDALLEMFRNEYIGTDPYISCTPSLRHYRLT--- 690

  Fly   416 SIPDEDNRDGDYGVLVMATDGLWDVSENDAVSRTVFQTLSKYSTEKHRYTMVAQELVARARGKIN 480
                |:::     .:|:::|||:....|..|.....:........:|    |.|||:.||..|..
plant   691 ----ENDQ-----FMVLSSDGLYQYLSNVEVVSLAMEKFPDGDPAQH----VIQELLVRAAKKAG 742

  Fly   481 DSGHWRLAD---SKAAATVDDISVIVI 504
            ...| .|.|   .......||.:|:||
plant   743 MDFH-ELLDIPQGDRRKYHDDCTVLVI 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17598NP_001259780.1 PP2Cc 98..506 CDD:238083 82/352 (23%)
PLL1NP_181078.2 PP2Cc <484..770 CDD:238083 82/352 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.