DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17598 and CG6036

DIOPT Version :9

Sequence 1:NP_001259780.1 Gene:CG17598 / 33140 FlyBaseID:FBgn0031194 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster


Alignment Length:357 Identity:73/357 - (20%)
Similarity:118/357 - (33%) Gaps:143/357 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GTGYAECVNS---GKSEWNEDQGAFCRQVLSDPEHKHPDLPYTYFGIFDGHAGYGAAL-AASHQF 156
            |.|...||:|   .:.|..:...|.||.       |.|...::||.:||||||...:| .|.|..
  Fly    23 GNGLRYCVSSMQGWRLEMEDSHSAACRL-------KDPFATWSYFAVFDGHAGSQISLHCAEHLM 80

  Fly   157 HHILHEKLVDCLELLLPRDADATNGGGEGNKLNPTFPHPIYFQRRVTKDELIIGALESAFFNMDS 221
            ..||..:                                     ..:|.:...| :...|..:| 
  Fly    81 STILESE-------------------------------------SFSKHKYEAG-IREGFLQLD- 106

  Fly   222 LIAQDCDR-YRDAGGCTACVSLFID-GKMYVANAGDSRAVLCQRRATPERPQTNTDSGIEPDPLE 284
               :|..: |.|..|.:..:.:|:. .|:|:.|.||||||:.:..|.                  
  Fly   107 ---EDMRKLYHDQQGGSTAICVFVSPDKIYLVNCGDSRAVISRNGAA------------------ 150

  Fly   285 ASCYPVPFSADHTPETERERLLNVARLKPHLMGKHYVAMEYAKRPHIKDMGQRILCRQGTMRGWT 349
                 |..:.||.|.:.:|                        :..|::.|..::.:        
  Fly   151 -----VISTIDHKPFSPKE------------------------QERIQNAGGSVMIK-------- 178

  Fly   350 YKTLTMEDLCMPVVNGEGKRSRLLGTLGVTRGFGDHELLAINTGIQIKPFLTPHPDVRQRDLTQV 414
                                 |:.|||.|:|.|||::.....:...:...::|.||:       :
  Fly   179 ---------------------RINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDI-------I 215

  Fly   415 VSIPDEDNRDGDYGVLVMATDGLWDVSENDAV 446
            |.     ||......:|:|.||:|||..:..|
  Fly   216 VC-----NRSEHDEFIVVACDGIWDVMTSSEV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17598NP_001259780.1 PP2Cc 98..506 CDD:238083 72/355 (20%)
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 71/353 (20%)
PP2C_C 284..352 CDD:285117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.