DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17598 and Ppm1

DIOPT Version :9

Sequence 1:NP_001259780.1 Gene:CG17598 / 33140 FlyBaseID:FBgn0031194 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster


Alignment Length:411 Identity:89/411 - (21%)
Similarity:140/411 - (34%) Gaps:152/411 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GAFCRQ---VLSDPEHKH----PDLPY-TYFGIFDGHAGYGAALAASHQFHHILHEKLVDCLELL 171
            |:.|.|   |..:..|.|    ||.|. .:|.::|||.|...|..|....|..:.::        
  Fly    25 GSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVAKYAGKHLHKFITKR-------- 81

  Fly   172 LPRDADATNGGGEGNKLNPTFPHPIYFQRRVTKDELIIGALESAFFNMDSLIAQDCDRYRDAGGC 236
                                   |.|      :|..|..||:.||.:.|..:.|:........||
  Fly    82 -----------------------PEY------RDNSIEVALKKAFLDFDREMLQNGSLDEQTAGC 117

  Fly   237 TACVSLFIDGKMYVANAGDSRAVLCQRRATPERPQTNTDSGIEPDPLEASCYPVPFSADHTPETE 301
            ||.|.|..:.::|.||||||||:.|             .||:    :.|      .|.||.|...
  Fly   118 TAIVVLIRERRLYCANAGDSRAIAC-------------ISGM----VHA------LSVDHKPNDA 159

  Fly   302 RERLLNVARLKPHLMGKHYVAMEYAKRPHIKDMGQRILCRQGTMRGWTYKTLTMEDLCMPVVNGE 366
            :|                               .:||:    ...||.                 
  Fly   160 KE-------------------------------SKRIM----ASGGWV----------------- 172

  Fly   367 GKRSRLLGTLGVTRGFGD--HELLAINTGIQIKPFLTPHPDVRQRDLTQVVSIPDEDNRDGDYGV 429
             :.:|:.|.|.::|..||  ::...:.|  ..:..:|.:|||...|:|:            |...
  Fly   173 -EFNRVNGNLALSRALGDFIYKKNLLKT--PEEQIVTAYPDVEVLDITE------------DLEF 222

  Fly   430 LVMATDGLWDVSENDAVSRTVFQTLSKYSTEKHRYTMVAQELVARARGKINDSGHWRLADSKAAA 494
            :::|.||:|||..|..|.    |.:.|...:.....::.:||:   ...::..||        ..
  Fly   223 VLLACDGIWDVMSNFEVC----QFVHKRIRDGMEPELICEELM---NSCLSPDGH--------TG 272

  Fly   495 TVDDISVIVIPVCQYYKEHVE 515
            .|...::.||.||..:.:..|
  Fly   273 NVGGDNMTVILVCLLHNKSYE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17598NP_001259780.1 PP2Cc 98..506 CDD:238083 86/400 (22%)
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 87/402 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13832
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.