DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17598 and CG10376

DIOPT Version :9

Sequence 1:NP_001259780.1 Gene:CG17598 / 33140 FlyBaseID:FBgn0031194 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster


Alignment Length:369 Identity:81/369 - (21%)
Similarity:125/369 - (33%) Gaps:146/369 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 YFGIFDGHAGYGAALAASHQFHHILHEKLVDCLELLLPRDADATNGGGEGNKLNPTFPHPIYFQR 200
            :||:||||:|..:|..|:.|...:|.::|                      |.|   |.|..|  
  Fly   195 FFGVFDGHSGSLSATYATSQLPQLLADQL----------------------KAN---PDPAAF-- 232

  Fly   201 RVTKDELIIGALESAFFNMDSLIAQDCDRYRDAGGCTACVSLFIDGKMYVANAGDSRAVLCQRRA 265
               ..:....|.||||...|....|.    :...|.|:..:|....::|:|..|||:|:|..:|.
  Fly   233 ---SPDFYRNAFESAFLLADERFTQK----KITSGTTSVCALITKDQLYIAWVGDSKALLVGKRT 290

  Fly   266 TPERPQTNTDSGIEPDPLEASCYPVPFSADHTPETERERLLNVARLKPHLMGKHYVAMEYAKRPH 330
            ..:.        ::|               |.||...||                      ||  
  Fly   291 QLQL--------VKP---------------HKPENPDER----------------------KR-- 308

  Fly   331 IKDMGQRILCRQGTMRGWTYKTLTMEDLCMPVVNGEGKRSRLLGTLGVTRGFGDHELLAINTGIQ 395
            |:..|..:|..||.   |                      |:.|.|.|.|..||:.|.|:     
  Fly   309 IETAGGTVLHAQGQ---W----------------------RVNGILNVARSIGDYSLEAV----- 343

  Fly   396 IKPFLTPHPDVRQRDLTQVVSIPDEDNRDGDYGVLVMATDGLWDVSENDAVSRTVFQTLSKYSTE 460
                      :.:.|...|     :.|...|:  ||:.||||||......:..||:.:|:.    
  Fly   344 ----------IAEPDFVDV-----QLNEAHDF--LVLGTDGLWDHVPESLIIETVYDSLAD---- 387

  Fly   461 KHRYTMVAQELVARARGKINDSGHWRLADSKAAATVDDISVIVI 504
               .||           |::|.....:..:|...:.|:|:.:|:
  Fly   388 ---TTM-----------KLDDIPKLLIEAAKERDSQDNITAVVV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17598NP_001259780.1 PP2Cc 98..506 CDD:238083 81/369 (22%)
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 81/369 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13832
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.