DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17598 and Ppm1n

DIOPT Version :9

Sequence 1:NP_001259780.1 Gene:CG17598 / 33140 FlyBaseID:FBgn0031194 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_006539883.1 Gene:Ppm1n / 232941 MGIID:2142330 Length:452 Species:Mus musculus


Alignment Length:317 Identity:76/317 - (23%)
Similarity:103/317 - (32%) Gaps:135/317 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PDLP--YTYFGIFDGHAGYGAA-LAASHQFHHILHEKLVDCLELLLPRDADATNGGGEGNKLNPT 191
            |.||  :.:|.:.|||.|..|| ..|.|...::|.|                         |.|.
Mouse    83 PGLPSGWAFFAVLDGHGGARAARFGARHLPGYVLGE-------------------------LGPA 122

  Fly   192 FPHPIYFQRRVTKDELIIGALESAFFNMDSLIAQDCDRYRDAGGCTACVSLFIDGKMYVANAGDS 256
            ...|          :.:..||.|||...|:.::....| .|.||.||...|.....:|:|:.|||
Mouse   123 PQEP----------DGVRQALRSAFLQADAQLSALWPR-GDPGGSTAVALLVSPRFLYLAHCGDS 176

  Fly   257 RAVLCQRRATPERPQTNTDSGIEPDPLEASCYPVPFSADHTPETERERLLNVARLKPHLMGKHYV 321
            ||:|.:..:.                  |.|     :.||.|...||                  
Mouse   177 RALLSRSGSV------------------AFC-----TEDHRPHRPRE------------------ 200

  Fly   322 AMEYAKRPHIKDMGQRILCRQGTMRGWTYKTLTMEDLCMPVVNGEGKRSRLLGTLGVTRGFGDHE 386
                  |..|.|.|       ||:|                      |.|:.|:|.|:|..||  
Mouse   201 ------RERIHDAG-------GTVR----------------------RRRVEGSLAVSRALGD-- 228

  Fly   387 LLAINTGIQIKPFLTPHPDVRQRDLTQVVSIPDE----DNRDGDYGVLVMATDGLWD 439
                        |.......|..:| |:||...|    ..:|.|..|| :|:||:||
Mouse   229 ------------FAYKQAPGRPPEL-QLVSAEPEVAALARQDEDEFVL-LASDGVWD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17598NP_001259780.1 PP2Cc 98..506 CDD:238083 76/317 (24%)
Ppm1nXP_006539883.1 PP2Cc 59..319 CDD:238083 76/317 (24%)
PP2C_C 313..387 CDD:369544
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834874
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.