DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6kII and YPK1

DIOPT Version :9

Sequence 1:NP_001259779.1 Gene:S6kII / 33139 FlyBaseID:FBgn0262866 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_012796.1 Gene:YPK1 / 853733 SGDID:S000001609 Length:680 Species:Saccharomyces cerevisiae


Alignment Length:337 Identity:150/337 - (44%)
Similarity:205/337 - (60%) Gaps:14/337 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 FELLRVLGEGSFGKVFLVRKIIGKDAGTLYAMKVLKKATLKVKDRVRST-NERKILADVGHAFIV 262
            |:||:|:|:||||||..|||   ||...:||:|.::|:.:..|..|..| .||.:||.|...|||
Yeast   347 FDLLKVIGKGSFGKVMQVRK---KDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIV 408

  Fly   263 RLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKP 327
            .|.::||:|.|||.:|.|:.||:||..|.||..|.....:||.|||..|:::||.|.::||||||
Yeast   409 PLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKP 473

  Fly   328 ENILLDEHGHIALTDFGLSKQPL-DGSKTYSFCGTVEYMAPEIVNRKGHDFAADWWSFGVLMYEM 391
            ||||||..|||||.||||.|..: |..||.:||||.||:|||::...|:..|.|||:.|||:|||
Yeast   474 ENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEM 538

  Fly   392 LTGNLPFHGQTRQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCF 456
            |||..|::.:...:...:||:..|..|:....:|:.||..|..|:|..||  |..|..:|:.|.|
Yeast   539 LTGLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRL--GYNGADEIRNHPF 601

  Fly   457 FATIDWVRLERKQVRPPFIPAVSRD-DAFYFDVEYTSKSPRDSPGGP-ISASAHEIFRGFSFVAP 519
            |:.:.|.||..|...||:.||||.. |...||.|:|.:.|.||.... :|.|..:.|.|:::|. 
Yeast   602 FSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVDEYLSESVQKQFGGWTYVG- 665

  Fly   520 VLLEGQCAGSNM 531
                .:..||:|
Yeast   666 ----NEQLGSSM 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kIINP_001259779.1 S_TKc 199..457 CDD:214567 122/259 (47%)
STKc_RSK_N 203..517 CDD:270734 143/317 (45%)
STKc_RSK_C 567..883 CDD:270993
S_TKc 568..834 CDD:214567
YPK1NP_012796.1 YPK1_N_like 116..342 CDD:212165
PKc_like 352..663 CDD:419665 143/315 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9248
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.