DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6kII and CTK1

DIOPT Version :9

Sequence 1:NP_001259779.1 Gene:S6kII / 33139 FlyBaseID:FBgn0262866 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_012783.1 Gene:CTK1 / 853718 SGDID:S000001622 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:78/331 - (23%)
Similarity:130/331 - (39%) Gaps:74/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 LRVL--GEGSFGKVFLVRKIIGKDAGTLYAMKVLKKATLKVKDRVRSTNERKILADVGHAFIVRL 264
            ||::  |||::|||:   |....:...|.|:|.|:....:....:.|..|.|:|....|..:..:
Yeast   184 LRIMQVGEGTYGKVY---KAKNTNTEKLVALKKLRLQGEREGFPITSIREIKLLQSFDHPNVSTI 245

  Fly   265 -HYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPE 328
             ....::...:|:|.::.........|:|||..:....|....:|.|.|.:||...|::||:|..
Yeast   246 KEIMVESQKTVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQLLLGMEYLHDNKILHRDVKGS 310

  Fly   329 NILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPE-IVNRKGHDFAADWWSFGVLMYEML 392
            |||:|..|::.:|||||:::....:...:...|:.|..|| ::....:....|.|..|.|:.|:.
Yeast   311 NILIDNQGNLKITDFGLARKMNSRADYTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCLLVELF 375

  Fly   393 TGNLPFHGQTRQETMNQILRSKLGMP--------------------------ENLSPEAQSLL-- 429
            .....|.|....|.:..|.:. :|.|                          .|.|.:.:|:|  
Yeast   376 NKTAIFQGSNELEQIESIFKI-MGTPTINSWPTLYDMPWFFMIMPQQTTKYVNNFSEKFKSVLPS 439

  Fly   430 ----------------------RAL----FKRNPQNRLGAGAQGILD--IKAHCFFATIDWVRLE 466
                                  .||    ||..|:..     ..:||  :..|.:     .|:|.
Yeast   440 SKCLQLAINLLCYDQTKRFSATEALQSDYFKEEPKPE-----PLVLDGLVSCHEY-----EVKLA 494

  Fly   467 RKQVRP 472
            |||.||
Yeast   495 RKQKRP 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kIINP_001259779.1 S_TKc 199..457 CDD:214567 71/314 (23%)
STKc_RSK_N 203..517 CDD:270734 77/330 (23%)
STKc_RSK_C 567..883 CDD:270993
S_TKc 568..834 CDD:214567
CTK1NP_012783.1 STKc_CDK9_like 183..469 CDD:270832 65/288 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.