Sequence 1: | NP_001259779.1 | Gene: | S6kII / 33139 | FlyBaseID: | FBgn0262866 | Length: | 911 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012783.1 | Gene: | CTK1 / 853718 | SGDID: | S000001622 | Length: | 528 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 331 | Identity: | 78/331 - (23%) |
---|---|---|---|
Similarity: | 130/331 - (39%) | Gaps: | 74/331 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 202 LRVL--GEGSFGKVFLVRKIIGKDAGTLYAMKVLKKATLKVKDRVRSTNERKILADVGHAFIVRL 264
Fly 265 -HYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPE 328
Fly 329 NILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPE-IVNRKGHDFAADWWSFGVLMYEML 392
Fly 393 TGNLPFHGQTRQETMNQILRSKLGMP--------------------------ENLSPEAQSLL-- 429
Fly 430 ----------------------RAL----FKRNPQNRLGAGAQGILD--IKAHCFFATIDWVRLE 466
Fly 467 RKQVRP 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
S6kII | NP_001259779.1 | S_TKc | 199..457 | CDD:214567 | 71/314 (23%) |
STKc_RSK_N | 203..517 | CDD:270734 | 77/330 (23%) | ||
STKc_RSK_C | 567..883 | CDD:270993 | |||
S_TKc | 568..834 | CDD:214567 | |||
CTK1 | NP_012783.1 | STKc_CDK9_like | 183..469 | CDD:270832 | 65/288 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |