| Sequence 1: | NP_001259779.1 | Gene: | S6kII / 33139 | FlyBaseID: | FBgn0262866 | Length: | 911 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_081188.1 | Gene: | Snx15 / 69024 | MGIID: | 1916274 | Length: | 337 | Species: | Mus musculus |
| Alignment Length: | 207 | Identity: | 40/207 - (19%) |
|---|---|---|---|
| Similarity: | 67/207 - (32%) | Gaps: | 55/207 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 PLADSQKDLRQQPQQQQQQQHVS---STSSSNNAEQQCSSSGLGLQLRQRMQITSSGCSSLAVTP 63
Fly 64 MEHT------PTEDDESGGGNSGVTSSVTTVTSSQRRQQLQQVQQQSALQAALEQHHISPTADLD 122
Fly 123 SARK--RPTHRTLCPPPELM-ELSDSESQG-------GVETG--------------GRREGATGR 163
Fly 164 SAPDLEDTEPLY 175 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| S6kII | NP_001259779.1 | S_TKc | 199..457 | CDD:214567 | |
| STKc_RSK_N | 203..517 | CDD:270734 | |||
| STKc_RSK_C | 567..883 | CDD:270993 | |||
| S_TKc | 568..834 | CDD:214567 | |||
| Snx15 | NP_081188.1 | PX_domain | 9..126 | CDD:383026 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 133..156 | 2/6 (33%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 244..270 | 4/25 (16%) | |||
| MIT_SNX15 | 267..337 | CDD:239140 | 15/67 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0603 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||