DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6kII and SNX15

DIOPT Version :9

Sequence 1:NP_001259779.1 Gene:S6kII / 33139 FlyBaseID:FBgn0262866 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_037438.2 Gene:SNX15 / 29907 HGNCID:14978 Length:342 Species:Homo sapiens


Alignment Length:218 Identity:44/218 - (20%)
Similarity:69/218 - (31%) Gaps:74/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 GTVEY-MAPEIVNRKGHDFAADWWSFGVLMYEMLTGNLPFHGQTRQETMNQILRSKLGMPENLSP 423
            |..|| :..:.:::|..:...:     |::::..:.....||.... |...:.|.....|  ..|
Human    24 GYTEYKVTAQFISKKDPEDVKE-----VVVWKRYSDFRKLHGDLAY-THRNLFRRLEEFP--AFP 80

  Fly   424 EAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFATIDWVRLERKQVRPPFIPAVSRDDAFYFDV 488
            .||...|  |:.:.......||:.:|....|                    |||::.        
Human    81 RAQVFGR--FEASVIEERRKGAEDLLRFTVH--------------------IPALNN-------- 115

  Fly   489 EYTSKSPRDSPGGPISASAHEIFRGFSFVAPVLLEGQCAGSNMCSTSASPLHSIAP--IPAAPVG 551
                           |....|.|||.....|:.:             :..||.:.|  ||..|..
Human   116 ---------------SPQLKEFFRGGEVTRPLEV-------------SRDLHILPPPLIPTPPPD 152

  Fly   552 APRTLPGVLPGNFHAEYNLLQEL 574
            .|| |..:||    ||...|:||
Human   153 DPR-LSQLLP----AERRGLEEL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kIINP_001259779.1 S_TKc 199..457 CDD:214567 19/97 (20%)
STKc_RSK_N 203..517 CDD:270734 27/157 (17%)
STKc_RSK_C 567..883 CDD:270993 4/8 (50%)
S_TKc 568..834 CDD:214567 3/7 (43%)
SNX15NP_037438.2 PX_domain 9..126 CDD:321991 26/154 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..267
MIT_SNX15 267..341 CDD:239140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.