DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6kII and Pkc98E

DIOPT Version :10

Sequence 1:NP_523437.2 Gene:S6kII / 33139 FlyBaseID:FBgn0262866 Length:911 Species:Drosophila melanogaster
Sequence 2:XP_061497978.1 Gene:Pkc98E / 1273220 VectorBaseID:AGAMI1_006338 Length:767 Species:Anopheles gambiae


Alignment Length:54 Identity:13/54 - (24%)
Similarity:20/54 - (37%) Gaps:12/54 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QKVQLWEKIMRCRIPWLLMERLIKTDTFPWKDQSLKRLCHQFCTRTLSTIVSHR 84
            |.|.||:.|  |....:...|:.|:..|          ||.......:.|::.|
Mosquito  1297 QVVLLWDTI--CFAFIIFQLRIFKSHYF----------CHIITDTKANNILASR 1338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kIINP_523437.2 STKc_RSK_N 203..517 CDD:270734
STKc_RSK_C 567..883 CDD:270993
Pkc98EXP_061497978.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.