DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)G0196 and Mfap1a

DIOPT Version :9

Sequence 1:NP_001097041.2 Gene:l(1)G0196 / 33137 FlyBaseID:FBgn0027279 Length:1846 Species:Drosophila melanogaster
Sequence 2:NP_001178893.1 Gene:Mfap1a / 499878 RGDID:1562232 Length:439 Species:Rattus norvegicus


Alignment Length:443 Identity:82/443 - (18%)
Similarity:147/443 - (33%) Gaps:134/443 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 SVPFQLDDPPIVPTTFGKMMELRCVVAVIRHGDRTPKQKMKVEVRHPKFFEIFEKYDGYKLGHVK 446
            |||..|...|.:.:|.|       .|.|.........:|:||:                  .:|.
  Rat     2 SVPSALMKQPPIQSTAG-------AVPVRNEKGEISMEKVKVK------------------RYVS 41

  Fly   447 LKRPKQLQEILDIARFLLSEIHTKAHAEIEEKESKLEQLKNVLEMYGHFSGINRKVQMKYQPKGR 511
            .|||.                    :|.:|..:.:.|:          |..|.:..:.:.:|:.:
  Rat    42 GKRPD--------------------YAPMESSDEEDEE----------FQFIKKAKEQEAEPEEQ 76

  Fly   512 PRGSSSD--------------DTNLAADQP-VEPSLVLILKWGGELTPAGRIQAEELGRIFRCMY 561
            ...||||              :..||..:. |||.:|            |...:|..|..:|.  
  Rat    77 EEDSSSDPRLRRLQNRISEDVEERLARHRKIVEPEVV------------GESDSEVEGDAWRL-- 127

  Fly   562 PGGQGRSDYSGTQ-----------GLGLLRLHSTFR--HDLKIY-ASDEGR------VQMTAAAF 606
                .|.|.|..:           ..|::|..:..|  .::::. ..||||      .:.....:
  Rat   128 ----EREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESESESEYEEY 188

  Fly   607 AKGLLALEGELTPILVQ-----MVKSANTNGLLDNDCDSSKYQNLAKGRLHELMQNDREFSKEDR 666
            ......:|..|.|:.::     .|:......|...:.:....:...:.|.:.|...:.|..||..
  Rat   189 TDSEDEMEPRLKPVFIRKKDRVTVQEREAEALRQKELEQEAKRMAEERRKYTLKIVEEETKKELE 253

  Fly   667 ELINPCNSKSITQALDFVK--NPVDCCHHVHLLIRELLHIISIKKDDPKTKDAILYHGETWDLMR 729
            |     |.:|:. |||.:.  :..|...:....:|||..|    |.|.:.::|:  ..|..::.|
  Rat   254 E-----NKRSLA-ALDALNTDDENDEEEYEAWKVRELKRI----KRDREDREAL--EKEKAEIER 306

  Fly   730 CR---WEKIEKDFSTKSKLFDISKIPDIYDCI-KYDLQHNQHTLQYDQAEELY 778
            .|   .|:...:.....|:.....:...|..: ||   :::.....|:.||:|
  Rat   307 MRNLTEEERRAELRANGKVITNKAVKGKYKFLQKY---YHRGAFFMDEDEEVY 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)G0196NP_001097041.2 His_Phos_2 402..926 CDD:278743 75/423 (18%)
Mfap1aNP_001178893.1 MFAP1 197..399 CDD:284422 35/175 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.