DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14618 and Trmt10c

DIOPT Version :9

Sequence 1:NP_608464.1 Gene:CG14618 / 33134 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_083368.1 Gene:Trmt10c / 52575 MGIID:1196261 Length:414 Species:Mus musculus


Alignment Length:285 Identity:70/285 - (24%)
Similarity:121/285 - (42%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TEKALKEVTPAMLSLNNCPGTTPGTPMSKNQLKKQRKLAEFAELRKLRREREREKKKQKRREAKE 68
            ||:.||       :|..|        .||:..||..:.....|..|..::.::|.|.:.|.|||.
Mouse   108 TEEDLK-------TLMEC--------ASKSAKKKYLRYLYGKEKAKKAKQVKKEMKAEAREEAKR 157

  Fly    69 LGLPVRTGPSRKE------LKKRQ--LADGGKS------GLSVAIDLDYDDLMQERDIVKCVKQC 119
            ..|...|...:::      |..||  :|.|.|.      |..:..|:.||:.|:..::...|.|.
Mouse   158 ARLLETTAEEQQQDFMFLRLWDRQINIALGWKGVQAMQFGQPLVFDMAYDNYMKPSELQNTVSQL 222

  Fly   120 LRIYTINRRSPQPGNLHFTGIRRNGHIHESFKK--NEGWENWHVQYYFDRGHTDIFEHSQLVYLT 182
            |.....|||:..|.:::|..::.:...|....|  .|.|:.. :....::...|:|....::|||
Mouse   223 LESEGWNRRNVDPFHIYFCNLKIDSAYHRELVKRYREKWDKL-LLTATEKSPVDLFPKDSIIYLT 286

  Fly   183 CESDRVLDKLQPGCTYVIGGLVDHNHFKGLCHSRATSAGLTTARLPLSEHVDMKT-RAVLSTYHV 246
            .:|..|:...:....|:||..||.|...|...::|....:.|..|||.:::..:. ...|:...:
Mouse   287 ADSPNVMTTFKHDKIYIIGSFVDKNTQTGTSLAKAKRLNIATECLPLDKYLQWEIGNKNLTLDQM 351

  Fly   247 FELLTKVAAGQDWTTAILETIPMRK 271
            ..:|..:....:|..| |:.:|.||
Mouse   352 IRILLCLKNTGNWEEA-LKFVPRRK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 38/168 (23%)
Trmt10cNP_083368.1 tRNA_m1G_MT 208..375 CDD:280003 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1545
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.