DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14618 and trmt10c

DIOPT Version :9

Sequence 1:NP_608464.1 Gene:CG14618 / 33134 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001007333.2 Gene:trmt10c / 492460 ZFINID:ZDB-GENE-041114-12 Length:403 Species:Danio rerio


Alignment Length:277 Identity:78/277 - (28%)
Similarity:118/277 - (42%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SKNQLKKQRKLAEFAELRKLRREREREKKKQKRREAKELGLPVRTGPSRKE-----------LKK 84
            :|:..||..|.....|.:|...:|::|||:.:|...|   |....|...:|           |:.
Zfish   107 TKSSKKKYLKFLAIKEAQKNNDKRKQEKKRAEREAGK---LQNNNGEEEEEERAAGPENTFMLRL 168

  Fly    85 R----------QLADGGKSGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTG 139
            |          :.|...:....:..|:.||..|...::...|.|.|.....|||..:|.:|||..
Zfish   169 RNNSIESAHNWRTAQAMRFDQPLVFDMSYDQQMSRHELENTVSQLLESEGFNRRVQEPFHLHFCN 233

  Fly   140 IRRNGHIHESFKKNEGWENWH--VQYYFDRGHTDIFEHSQLVYLTCESDRVLDKLQPGCTYVIGG 202
            ::..|..|....:..|.|.|.  :..:.:|...::|.|..|||||.:|..||........|::|.
Zfish   234 LQPGGAYHRELLRRYGDETWRRLLITHTERSPLELFPHQDLVYLTADSRSVLRTFDHTKVYIVGA 298

  Fly   203 LVDHNHFKGLCHSRATSAGLTTARLPLSEHVDMKTRAV-LSTYHVFELLTKVAAGQDWTTAILET 266
            :||.:...|...:.|....|.||||||.|::|....|. |:...:..:||.|.....|..| ||.
Zfish   299 MVDRSIRVGASLAIAKRFRLATARLPLDEYLDWDCGAKNLTLDQMIRILTTVKQTGCWQKA-LEF 362

  Fly   267 IPMR--KGAKAKITDKK 281
            :|.|  ||...:..||:
Zfish   363 VPKRKHKGFHQQSGDKR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 53/170 (31%)
trmt10cNP_001007333.2 tRNA_m1G_MT 199..367 CDD:294285 52/168 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1545
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.