DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14618 and Trmt10c

DIOPT Version :9

Sequence 1:NP_608464.1 Gene:CG14618 / 33134 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001008338.1 Gene:Trmt10c / 304012 RGDID:1306333 Length:414 Species:Rattus norvegicus


Alignment Length:286 Identity:72/286 - (25%)
Similarity:123/286 - (43%) Gaps:36/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TEKALKEVTPAMLSLNNCPGTTPGTPMSKNQLKKQRKLAEFAELRKLRREREREKKKQKRREAKE 68
            ||:.||       :|..|        .||:..||..:.....|:.|..::.::|.|...|.|||.
  Rat   108 TEEELK-------TLMEC--------ASKSAKKKYLRYLYGKEMMKKAKQMKKEMKAAAREEAKR 157

  Fly    69 L-GLPVRTGPSRKEL-------KKRQLADGGKS------GLSVAIDLDYDDLMQERDIVKCVKQC 119
            . .|...||..:::.       ::..:|.|.|.      |..:..|:.||:.|:..::...|.|.
  Rat   158 ARSLEPSTGEEQRDFMFLRLWDRQTNIALGWKGVQAMQFGQPLVFDMAYDNYMKPSELQNTVSQL 222

  Fly   120 LRIYTINRRSPQPGNLHFTGIRRNGHIHESFKKNEGWENWH--VQYYFDRGHTDIFEHSQLVYLT 182
            |.....|||:..|.:::|..:..:|..|....|..| |.|.  :....::...|:|....::|||
  Rat   223 LESEGWNRRNVDPFHIYFCNLEVDGAYHRELVKRYG-EKWDKLLLTATEKSPVDLFPKDSIIYLT 286

  Fly   183 CESDRVLDKLQPGCTYVIGGLVDHNHFKGLCHSRATSAGLTTARLPLSEHV--DMKTRAVLSTYH 245
            .:|..|:...:....|:||..||.|...|...::|....|.|..|||.:::  |:..:. |:...
  Rat   287 ADSPNVMTTFKHDKIYIIGSFVDKNTQTGTSLAKAKRQNLATECLPLDKYLQWDVGNKN-LTLDQ 350

  Fly   246 VFELLTKVAAGQDWTTAILETIPMRK 271
            :..:|..:....:|..| |:.:|.||
  Rat   351 MIRILLCLKNTGNWEEA-LKFVPRRK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 42/169 (25%)
Trmt10cNP_001008338.1 tRNA_m1G_MT 208..375 CDD:280003 42/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.