DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14618 and C56G2.3

DIOPT Version :9

Sequence 1:NP_608464.1 Gene:CG14618 / 33134 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001367605.1 Gene:C56G2.3 / 183866 WormBaseID:WBGene00016978 Length:405 Species:Caenorhabditis elegans


Alignment Length:338 Identity:79/338 - (23%)
Similarity:127/338 - (37%) Gaps:72/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EKALKEVTPAMLSLNNCPGTTPGTPMSKNQLKKQRKLAE-----------FAELRKLRRER---- 54
            |.||||....:......|     |.|| ::..||..:.|           .|...|.||.|    
 Worm    68 ETALKEFEIFVYMGKYVP-----TRMS-DEAWKQTLICESINDKIGYWEYLAVTDKRRRSRNKAQ 126

  Fly    55 ----EREKK----KQKRREAKELG-----LPVRTGPSRKELKKRQLADGGK------SGL-SVAI 99
                |..||    :|:...|..:|     ..|.:.|.|.: |:....:|.|      ||. .:|:
 Worm   127 SSGAENYKKVLEEQQRIYTAGGMGYGPEMYQVISNPMRNQ-KRVNNIEGSKIFAAMNSGAPRIAL 190

  Fly   100 DLDYDDLMQERDIVKCVKQCLRIYTI--NRRSPQPGNLHFTGIRRNGHIHESFKKNEGWENWH-- 160
            |:.|.:.|.:||..:...|..  |||  |..:..|..|.|........:.:...|:.|:...:  
 Worm   191 DIQYVEEMNKRDSGELGNQMQ--YTISENFSAKSPFVLDFVNSPSKEFLEQWLSKSVGYYTGNYI 253

  Fly   161 ----VQYYFDRGHTDIF-EHSQLVYLTCESDRVLDKLQPGCTYVIGGLVDHNHFKGLCHSRATSA 220
                :..:..:|..:.: :.:..:|::..:..|||  .|....|||..|.... |....|.|..|
 Worm   254 NQTILPDFSTKGIKEFYGKSANTIYISSNARDVLD--GPLTADVIGICVTMGR-KREALSAARRA 315

  Fly   221 GLTTARLPLSEHVDMKT-RAVLSTYHVFELLTKV-AAGQDWTTAILETIPMRKGAKAKITDKKEP 283
            .:...|||:..:|..|: ...|...::..:|.:| ..|.||:.|:...|..|             
 Worm   316 NIRAYRLPIHRYVKWKSGPQYLPFPNIMNVLREVYMNGGDWSRALHNNISKR------------- 367

  Fly   284 NHCLEQQDEKQKQ 296
             |.:...|::||:
 Worm   368 -HLVNADDDEQKK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 40/176 (23%)
C56G2.3NP_001367605.1 SPOUT_MTase 186..367 CDD:422952 43/185 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.