DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14618 and TRMT10B

DIOPT Version :9

Sequence 1:NP_608464.1 Gene:CG14618 / 33134 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_011516037.1 Gene:TRMT10B / 158234 HGNCID:26454 Length:329 Species:Homo sapiens


Alignment Length:252 Identity:66/252 - (26%)
Similarity:122/252 - (48%) Gaps:15/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SKNQLKKQRKLAEFAELRKLRREREREKKKQKRREAKELGLPVRTGPSRKELKKRQLADGGKSGL 95
            |||..:|||...:....:|.:|::|:|::|..|.|...: .|..:....:.|.|.:|.:...||.
Human    75 SKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPGI-CPQHSKRFLRALTKDKLLEAKHSGP 138

  Fly    96 SVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTGIRRNGHIHES-FKKNEGWENW 159
            .:.|||.....|.::::.:...|..|:|..|:::.:|..:..||...:..::|. .:.|:|:.: 
Human   139 RLCIDLSMTHYMSKKELSRLAGQIRRLYGSNKKADRPFWICLTGFTTDSPLYEECVRMNDGFSS- 202

  Fly   160 HVQYYFDRGHTD---IFEHSQLVYLTCESDRVLDKLQPGCTYVIGGLVDHNHFKGLCHSRATSAG 221
               |..|....|   :|....|||||.:|:..|:.:.....|::|||||.:..|.:...:|....
Human   203 ---YLLDITEEDCFSLFPLETLVYLTPDSEHALEDVDLNKVYILGGLVDESIQKKVTFQKAREYS 264

  Fly   222 LTTARLPLSEHVDMKTRA------VLSTYHVFELLTKVAAGQDWTTAILETIPMRKG 272
            :.|||||:.|::......      :|:...||::|:......:|..|:.:.:...||
Human   265 VKTARLPIQEYMVRNQNGKNYHSEILAINQVFDILSTYLETHNWPEALKKGVSSGKG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 42/175 (24%)
TRMT10BXP_011516037.1 tRNA_m1G_MT 149..320 CDD:294285 42/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1396299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.