DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14618 and trmt10c

DIOPT Version :9

Sequence 1:NP_608464.1 Gene:CG14618 / 33134 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001096307.1 Gene:trmt10c / 100124885 XenbaseID:XB-GENE-877279 Length:448 Species:Xenopus tropicalis


Alignment Length:265 Identity:71/265 - (26%)
Similarity:110/265 - (41%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SKNQLKKQRKLAEFAELRKL-RREREREKKKQKRR-------EAKELGLPVRTGPSRKE------ 81
            :|...||..|.....|:.|. |:|:::|.|:.|.:       |.||      ..|.:|.      
 Frog   123 TKTARKKYLKYLSVREVMKTNRKEKKKELKESKSKIESLDQLETKE------DTPEKKNTFLLHV 181

  Fly    82 -------LKKRQLADGGKSGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTG 139
                   :::.:.....|.|..:..|:.|:..|...::...|.|.:.....||||..|.:::|..
 Frog   182 WDKSIDTMQRWKCVQAMKFGQPLVFDMVYEKNMSRYELENTVCQLMESEGWNRRSTDPFHIYFCS 246

  Fly   140 IRRNGHIHESFKKN--EGWENWHVQYYFDRGHTDIFEHSQLVYLTCESDRVLDKLQPGCTYVIGG 202
            ::.....|:...|.  ..|:|..|. ..|:.|.::|...||||||.:|...|........|:||.
 Frog   247 LQPYSMYHKELVKRYIGAWDNVFVT-ATDKSHVEMFPKEQLVYLTADSPNELKHFDHTKIYIIGS 310

  Fly   203 LVDHNHFKGLCHSRATSAGLTTARLPLSEHVDMKTRAV-LSTYHVFELLTKVAAGQDWTTAILET 266
            |||.....||..:.|....|.||||||..::.....|. |:...:..:|..:....||..| |..
 Frog   311 LVDRCQQTGLSLANAKRLNLATARLPLDRYLKWDVGAKNLTLDQMIRILLCLKDTGDWKKA-LSF 374

  Fly   267 IPMRK 271
            :|.||
 Frog   375 VPNRK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 49/168 (29%)
trmt10cNP_001096307.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..167 6/22 (27%)
tRNA_m1G_MT 214..379 CDD:294285 49/166 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..448
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1545
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.