DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14613 and Fam210a

DIOPT Version :10

Sequence 1:NP_608463.1 Gene:CG14613 / 33133 FlyBaseID:FBgn0031188 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001007689.1 Gene:Fam210a / 307343 RGDID:1359600 Length:273 Species:Rattus norvegicus


Alignment Length:197 Identity:67/197 - (34%)
Similarity:100/197 - (50%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LANRRNLLLPTVNIRFNHKSANPAAAAPAP------------AINNSSAGGKDLKATNSTTSSEL 98
            ||.:||||           .|.|......|            .:::||        |:..|.||.
  Rat    64 LAKQRNLL-----------DAQPPQRGALPQGRWEQDILSKRVLSSSS--------TSQETPSEK 109

  Fly    99 FGEA-----ANMGLFAKFKHMYKQYWYVLIPVHVLTSVGWFGGFYYLSKSGVDVPALLQYIHLSE 158
            ..|.     .::.|:.:||..::||..||||||::||..|||.|||.|..||:|...|:::.|.:
  Rat   110 KEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGIWFGTFYYASIKGVNVIPFLEFLGLPD 174

  Fly   159 NIIEKVQGSDMGHYAIAYLCYKVATPLRYALTLGCTTVSIKYLVQHGYIK-PMPTKSELIKMYED 222
            ::::.::.|..|:...||..:|:|||.||.:|||.|:.::|||..|||:. |.|.|..|....|:
  Rat   175 SVVDILKNSQSGNALTAYAMFKIATPARYTVTLGGTSFTVKYLRSHGYMSTPPPVKEYLQGRMEE 239

  Fly   223 KK 224
            .|
  Rat   240 TK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14613NP_608463.1 FAM210A-B_dom 109..194 CDD:429191 37/84 (44%)
Fam210aNP_001007689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..116 7/28 (25%)
FAM210A-B_dom 125..212 CDD:429191 38/86 (44%)
YtxH <238..273 CDD:432750 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..273
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.