DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14613 and FAM210A

DIOPT Version :10

Sequence 1:NP_608463.1 Gene:CG14613 / 33133 FlyBaseID:FBgn0031188 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_689565.2 Gene:FAM210A / 125228 HGNCID:28346 Length:272 Species:Homo sapiens


Alignment Length:122 Identity:52/122 - (42%)
Similarity:78/122 - (63%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 NMGLFAKFKHMYKQYWYVLIPVHVLTSVGWFGGFYYLSKSGVDVPALLQYIHLSENIIEKVQGSD 168
            ::.|:.:||..::||..||||||::||..|||.|||.:..||:|...|:.|.|.::::..::.|.
Human   119 SISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQ 183

  Fly   169 MGHYAIAYLCYKVATPLRYALTLGCTTVSIKYLVQHGYIK-PMPTKSELIKMYEDKK 224
            .|:...||..:|:|||.||.:|||.|:|::|||..|||:. |.|.|..|....|:.|
Human   184 SGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14613NP_608463.1 FAM210A-B_dom 109..194 CDD:429191 37/84 (44%)
FAM210ANP_689565.2 FAM210A-B_dom 124..211 CDD:429191 38/86 (44%)
YtxH <237..272 CDD:432750 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..272
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.