DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp2 and Usp26

DIOPT Version :9

Sequence 1:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_113565.2 Gene:Usp26 / 83563 MGIID:1933247 Length:835 Species:Mus musculus


Alignment Length:268 Identity:62/268 - (23%)
Similarity:107/268 - (39%) Gaps:67/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 GLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKD------QQILHEFAKLIQEMWTAN 684
            ||.|:||||::|.|:|.|.........|.:.......:.||      .|:|     ::::::.|.
Mouse   287 GLPNVGNTCYINVVLQSLCSIPLFINDLFNQGFPWIKAPKDDFNMLLMQLL-----VLKDIYNAR 346

  Fly   685 VHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLSDNKKAD 749
            ......:.:.:|......:::...|.||.|||...|..|......                    
Mouse   347 FRQKLLIGITKALPIFGEIFAVDRQNDAHEFLSLCLVQLKETFQR-------------------- 391

  Fly   750 LTWEWYTRHENS---LVRDLFVG------------------QLKSTLKCTTCGNTSVTFDPFWDL 793
            :|..|.:.:::.   |::|:|..                  :|.|::.|..||.|....:|...|
Mouse   392 VTMMWQSENDSGDFYLLKDIFADYATINKMPVCPVTNNFEFELLSSIFCKACGLTLFKGEPSRYL 456

  Fly   794 SVPLPSSSR-CKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRF---PKYLVIHLKR 854
            |:.:|...: ..:::.||||...|.|:    ..|.||    ...||.:..||   |:.:::||||
Mouse   457 SINIPQGGKDMSIQSTLDLFFSAEELE----HRCEKC----LYNKSVSFHRFGRLPRVIIVHLKR 513

  Fly   855 --FSETRW 860
              |:|: |
Mouse   514 YHFNES-W 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp2NP_001285528.1 UCH 624..947 CDD:278850 62/268 (23%)
Peptidase_C19R 626..948 CDD:239139 62/268 (23%)
Usp26NP_113565.2 UCH_N 3..104 CDD:374714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..128
UCH 287..>553 CDD:366104 62/268 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 597..747
Peptidase_C19 <747..814 CDD:239072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.