DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp2 and Usp27x

DIOPT Version :9

Sequence 1:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_062334.2 Gene:Usp27x / 54651 MGIID:1859645 Length:438 Species:Mus musculus


Alignment Length:369 Identity:107/369 - (28%)
Similarity:164/369 - (44%) Gaps:66/369 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 GLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKDQQILHEFAKLIQEMWTANVHT 687
            ||.||.|:|||||||.::|.|:||..|..|..|......:.:.:..::.|.:.|.:|:::.|...
Mouse    76 GLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSP 140

  Fly   688 VTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLSDNKKADLTW 752
            ..|.:|........|..:.|.||||.|||...||.||    ...||:.:.   .::.|       
Mouse   141 HVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLH----RHCKGDDVG---KVASN------- 191

  Fly   753 EWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRC-------------- 803
               ..|.|.::..:|.|.|:|.:.|..|...|.|.||.||:|:.||.|  |              
Mouse   192 ---PNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGS--CTSFWPMSPGRESSL 251

  Fly   804 ----------KLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF--S 856
                      .|..||..|.|.|.|.......|..|::.::.||..|:::.|.....|.|||  |
Mouse   252 NGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMKKLPVVACFHFKRFEHS 316

  Fly   857 ETRWSKLSNIVEFPTSDSELNMGSYGANS----------------NSNVHYSLYAISNHMGSTAG 905
            ..:..|::..:.||.   ||:|..:.|:|                |:...|||:|:.||.|:...
Mouse   317 AKQRRKITTYISFPL---ELDMTPFMASSKETRVNGQLQLPTNSANNENKYSLFAVVNHQGTLES 378

  Fly   906 GHYVALCKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYER 949
            |||.:..:|. ..:|.:.:|.:::.| |...::.|..|:|||.:
Mouse   379 GHYTSFIRHH-RDQWFKCDDAVITKA-SIKDVLDSEGYLLFYHK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp2NP_001285528.1 UCH 624..947 CDD:278850 104/364 (29%)
Peptidase_C19R 626..948 CDD:239139 104/363 (29%)
Usp27xNP_062334.2 UCH 77..418 CDD:278850 104/364 (29%)
Peptidase_C19D 78..419 CDD:239125 104/364 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.