DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp2 and USP50

DIOPT Version :9

Sequence 1:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_987090.2 Gene:USP50 / 373509 HGNCID:20079 Length:334 Species:Homo sapiens


Alignment Length:308 Identity:91/308 - (29%)
Similarity:144/308 - (46%) Gaps:26/308 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 EGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKDQQILHEFAKLIQEMWTANVH 686
            :|:.||.|:||||.:|::.|||.....|..:..:.....:|.....::...||.|:.:||..:..
Human    41 QGVTGLWNLGNTCCVNAISQCLCSILPLVEYFLTGKYITALQNDCSEVATAFAYLMTDMWLGDSD 105

  Fly   687 TVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSAL--------NSGVKGETLNIDDNLS 743
            .|:|.....|....:..::...||||||||...|:.||.||        .|..||.|..      
Human   106 CVSPEIFWSALGNLYPAFTKKMQQDAQEFLICVLNELHEALKKYHYSRRRSYEKGSTQR------ 164

  Fly   744 DNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 808
                  ...:|.|. |.|::..||..||..::.|..|...:...:.|...|:|:||...|.|..|
Human   165 ------CCRKWITT-ETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDC 222

  Fly   809 LDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF--SETRWSKLSNIVEFPT 871
            |..|.:::.|..:....|:.|:|:::.....:|.:.||.::.|||||  ..|...||...:.:|.
Human   223 LQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHYPL 287

  Fly   872 SDSELNMGSYGAN-SNSNVHYSLYAISNHMGSTAGGHYVALCKHPVSR 918
            ::  |::..|..: ......|:|.|:.||.|...||||.|.||:.|::
Human   288 TN--LDLTPYICSIFRKYPKYNLCAVVNHFGDLDGGHYTAFCKNSVTQ 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp2NP_001285528.1 UCH 624..947 CDD:278850 90/306 (29%)
Peptidase_C19R 626..948 CDD:239139 90/304 (30%)
USP50NP_987090.2 Peptidase_C19R 45..333 CDD:239139 90/302 (30%)
UCH_1 45..326 CDD:290159 86/295 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469048at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.