DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp2 and Usp20-33

DIOPT Version :9

Sequence 1:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_610943.2 Gene:Usp20-33 / 36580 FlyBaseID:FBgn0033916 Length:975 Species:Drosophila melanogaster


Alignment Length:515 Identity:131/515 - (25%)
Similarity:199/515 - (38%) Gaps:151/515 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   574 PTSSRYWDRDSGTSRSSIGTSSALNSSSLKHNSDDGYKTASSSRDEKSEGLCGLRNIGNTCFMNS 638
            |.|||..|:....|..|:......|:|     ..:|..||..|    ..||.||:||.|||:|||
  Fly    38 PRSSRCHDKLFSGSLKSLARREDSNAS-----DSEGTDTAKGS----GTGLVGLQNIANTCYMNS 93

  Fly   639 VIQCLSHTQELTRF------LRSHHGSRSL-STKDQQILHEFAKLIQEMWTANV----HTVTPME 692
            .:|.||:...:|.:      |..:...:|. ..|...:...:.:|:||:| .:|    ..:.|..
  Fly    94 ALQALSNLPPMTHYFINCSDLVEYIAEQSARRCKPGGLAKSYRRLMQEIW-QDVDDPKEFIAPRG 157

  Fly   693 LKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVK--GETLN--------------IDDN 741
            :.....|.|.|:..|.|.|.|||||.|:|.||..|...|.  .:|.|              .||.
  Fly   158 ILYGIRTVHPMFRGYQQHDTQEFLRCFMDQLHEELTEQVSMLPQTQNQPQYQSLQQQQPSETDDE 222

  Fly   742 LSD-----------------------NKKAD--LTWEWYT------------------------- 756
            ..|                       .:.|:  |..|::.                         
  Fly   223 NDDEAAPASLSHASESEYDTCESSMSERSAEVLLKTEYFVTPCRTNGSNSGLPEGHSVQLQQAPL 287

  Fly   757 RHE---------------NSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLP-------- 798
            :|:               .|::.|:|.|:|.|:::|.||...|...:.|.|||:|:|        
  Fly   288 QHQQKNASSAEQKPIEAARSIISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPNRDFLNVL 352

  Fly   799 ---------------SSSRCK---------------------LEACLDLFIREEVLDGDEMPTCA 827
                           :|:|..                     |..|:..|...:.|.||.|.:|.
  Fly   353 HQTHSLSVQSLNAAETSARTNEGWLSWMWNMLRSWIYGPSVTLYDCMASFFSADELKGDNMYSCE 417

  Fly   828 KCKTRRKCTKSFTIQRFPKYLVIHLKRFSE--TRWSKLSNIVEFPTSDSELNMGSYGANSNSNVH 890
            :|...|...|...:...|:.|.||||||..  :..||:|:.|.||....::....:....:....
  Fly   418 RCNKLRTGIKYSRVLTLPEVLCIHLKRFRNDLSYSSKISSDVYFPLEGFDMRPYIHKDCKSEVAI 482

  Fly   891 YSLYAISNHMGSTAGGHYVALCKHPVSRKWHEFNDNIVSDALSENHLVSS-SAYILFYER 949
            |:|.::..|.|:..||||....::.::.||:||:|..|::..||  ||.| .||:|||.:
  Fly   483 YNLSSVICHHGTVGGGHYTCFARNTLNGKWYEFDDQFVTEVSSE--LVQSCQAYVLFYHK 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp2NP_001285528.1 UCH 624..947 CDD:278850 115/461 (25%)
Peptidase_C19R 626..948 CDD:239139 115/460 (25%)
Usp20-33NP_610943.2 UCH 79..538 CDD:278850 115/461 (25%)
Peptidase_C19 80..>204 CDD:271592 41/124 (33%)
Peptidase_C19R 307..538 CDD:239139 65/232 (28%)
DUSP 560..643 CDD:197831
DUSP 667..755 CDD:197831
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21646
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.