DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp2 and Usp26

DIOPT Version :9

Sequence 1:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_001100418.1 Gene:Usp26 / 302488 RGDID:1563443 Length:827 Species:Rattus norvegicus


Alignment Length:269 Identity:64/269 - (23%)
Similarity:113/269 - (42%) Gaps:68/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 GLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKD------QQILHEFAKLIQEMWTAN 684
            ||.|:||||::|.|:|.|.........|.:.........||      .|:|     ::::::.|.
  Rat   288 GLPNVGNTCYINVVLQSLCSIPLFVNDLFNQGFPWIKPPKDDFNMRLMQLL-----VLKDIYNAR 347

  Fly   685 VHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLSDNKKAD 749
            ......:.:.:|......:::...|.||.|||...|..|.         ||:         ::.:
  Rat   348 TRQKLLIGITKALPIFGEVFAADRQNDAHEFLSLCLVQLK---------ETV---------QRVN 394

  Fly   750 LTWEWYTRHENS---LVRDLFVG------------------QLKSTLKCTTCGNTSVTFDPFWDL 793
            :.|:  :.:|:.   |:|::|..                  :|.|::.|..||.|....:|...|
  Rat   395 MMWQ--SENESGDYYLLREIFANYTSINRTPVCPVTNNFEFELLSSIFCKACGLTVFKREPSRYL 457

  Fly   794 SVPLPSSSR---CKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRF---PKYLVIHL 852
            |:.:|...:   ..:::.||||.|.|.|:    ..|.:|    ...||..:.:|   |:.:::||
  Rat   458 SINIPQGMKDQNMSIQSSLDLFFRAEELE----HRCERC----LYNKSVALHKFGRLPRVIIVHL 514

  Fly   853 KR--FSETR 859
            ||  |||:|
  Rat   515 KRYSFSESR 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp2NP_001285528.1 UCH 624..947 CDD:278850 64/269 (24%)
Peptidase_C19R 626..948 CDD:239139 64/269 (24%)
Usp26NP_001100418.1 UCH_N 3..103 CDD:406959
COG5077 181..>378 CDD:227409 21/94 (22%)
UCH 288..557 CDD:395355 64/269 (24%)
Peptidase_C19 <740..805 CDD:351799
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.