DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp2 and ubp8

DIOPT Version :9

Sequence 1:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_592992.1 Gene:ubp8 / 2542135 PomBaseID:SPAC13A11.04c Length:449 Species:Schizosaccharomyces pombe


Alignment Length:353 Identity:80/353 - (22%)
Similarity:143/353 - (40%) Gaps:91/353 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 GLCGLRNIGNTCFMNSVIQCLSHTQELTR--FLRSHHGSRS------------------LSTKDQ 667
            ||.|::|:|.||||:.::|.:.| ..|.|  |....|.|..                  .::|::
pombe   143 GLRGIQNLGATCFMSVILQSILH-NPLVRNLFFSGFHTSTDCKRPTCMTCAIDDMFSSIYNSKNK 206

  Fly   668 QILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVK 732
            ...:....::..||..:                 :....|:|||..||..:.||.:|:....|  
pombe   207 STFYGPTAVLNLMWKLS-----------------KSLCGYSQQDGHEFFVYLLDQMHTESGGG-- 252

  Fly   733 GETLNIDDNLSDNKKADLTWEWYTRHENSL-----VRDLFVGQLKSTLKCTTCGNTSVTFDPFWD 792
                                       .|:     :..:|.|.||:.:.|..|....|..||..|
pombe   253 ---------------------------TSMPCTCPIHRIFSGSLKNVVTCLDCKKERVAVDPLMD 290

  Fly   793 LSVPLPSSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRFSE 857
            :|:.:...:   |:.||:.|:.:|.:    ..:|..|.: :...|.....:.|..:.:.||||.:
pombe   291 ISLDINEPT---LQGCLERFVSKEKV----QYSCHSCGS-KNAIKQLVFDKLPPTICMQLKRFEQ 347

  Fly   858 TRW---SKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVSRK 919
            ..:   :|:...|.:|   :.|.| .|..|.: :|.|.||::..|.|:...|||:|...:  ..:
pombe   348 NNFAMSTKIDKQVSYP---AFLRM-RYNFNQD-DVDYQLYSVVCHKGTLDTGHYIAYTYY--QNQ 405

  Fly   920 WHEFNDNIVSDALSENHLVSSSAYILFY 947
            |...:|..:.: :.|:.:::|.||:|||
pombe   406 WFLLDDTTIVE-VKESEVLNSQAYLLFY 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp2NP_001285528.1 UCH 624..947 CDD:278850 77/350 (22%)
Peptidase_C19R 626..948 CDD:239139 78/350 (22%)
ubp8NP_592992.1 ZnF_UBP 37..85 CDD:197632
UCH 144..432 CDD:278850 77/350 (22%)
Peptidase_C19D 145..433 CDD:239125 78/351 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.