DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and SDS22

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_012728.1 Gene:SDS22 / 853641 SGDID:S000001676 Length:338 Species:Saccharomyces cerevisiae


Alignment Length:158 Identity:51/158 - (32%)
Similarity:75/158 - (47%) Gaps:28/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVENL 84
            :|.||||.|.:..|..:.::.. .::||||.:|||.:.::|||.:|..||.|.::.|.|.::|.|
Yeast   180 LSNLEEIWLGKNSIPRLINLHP-LKNLKILSIQSNKLKKIENLEELTNLEELYLSHNFITKIEGL 243

  Fly    85 EGCESLSKLDLT---------LNFIRELT-----------SVESLCGNYN----LRELVLIGNP- 124
            |....|:.||:|         ||.:..||           |.|||..|.:    |..:.|.||| 
Yeast   244 EKNLKLTTLDVTSNKITSLENLNHLSNLTDIWASFNKIDQSFESLGENLSALSRLETIYLEGNPI 308

  Fly   125 -CVDYPHYRDYVVATL-PQLNSLDCVEI 150
             ..:...||..:...| |.|..:|...|
Yeast   309 QLENKTSYRRKLTMNLPPSLQKIDATYI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 51/158 (32%)
leucine-rich repeat 23..45 CDD:275378 6/21 (29%)
LRR_4 46..86 CDD:289563 18/39 (46%)
leucine-rich repeat 46..67 CDD:275378 11/20 (55%)
leucine-rich repeat 68..89 CDD:275378 8/20 (40%)
leucine-rich repeat 90..114 CDD:275378 13/43 (30%)
SDS22NP_012728.1 inl_like_NEAT_1 <42..>174 CDD:411101
leucine-rich repeat 44..67 CDD:275380
leucine-rich repeat 68..91 CDD:275380
leucine-rich repeat 92..114 CDD:275380
PPP1R42 112..332 CDD:411060 49/152 (32%)
leucine-rich repeat 115..136 CDD:275380
leucine-rich repeat 137..158 CDD:275380
leucine-rich repeat 159..182 CDD:275380 0/1 (0%)
leucine-rich repeat 183..204 CDD:275380 6/21 (29%)
leucine-rich repeat 205..248 CDD:275380 19/42 (45%)
leucine-rich repeat 249..270 CDD:275380 6/20 (30%)
leucine-rich repeat 271..294 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54194
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.