DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and LRRIQ1

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_011537119.1 Gene:LRRIQ1 / 84125 HGNCID:25708 Length:1760 Species:Homo sapiens


Alignment Length:411 Identity:89/411 - (21%)
Similarity:156/411 - (37%) Gaps:107/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLITEELVRKKSEHNERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKL 65
            ::|...:|:..|...:...|..|:....|..|:|.:|:    |..|:||.||.|.::.|.:|..|
Human   974 LILDHNQLINTKGLCDTPTIVYLDCSHNHLTDVEGVEN----CGLLQILKLQGNYLSELPSLENL 1034

  Fly    66 KRLEYLNVAINNIERVE-----------NLEGCE-------------SLSKLDLTLNFIRELTS- 105
            ..|..|::..|:|..||           |:...:             ||.|||::.|.:.:|.| 
Human  1035 VLLRELHLDDNSISTVEAFSSYWLPLLQNITISQNSLTKIVPLFHFVSLEKLDVSHNCLSDLKSA 1099

  Fly   106 VESLCGNYNLRELVLIGNPCVDYPHYRDYVVATLPQLNSLDCVEITPSERLRALRELSKNRSIIV 170
            ::.....|:|.||.|.|||.:...::||.::..||                 |||.|:.|   |:
Human  1100 IKWFDACYSLHELSLTGNPLLQETNWRDSLLKVLP-----------------ALRILNGN---IL 1144

  Fly   171 QKQVEQDIERDEQRIR---VAKQQSALAEHCAGIE------------DEEERIKAFWQAKSEHCP 220
            ....|...|...|...   :|..||.:.|....||            |..|.:..::    :...
Human  1145 NSNSESRTEEHNQLGSAGFLALCQSQIREFNLLIENYITGKGDVFTLDTAENLCHYF----KKLM 1205

  Fly   221 EIRTEIARQHRLG----RERHETKSPLDPLKP-------QRNLFAPCGRPYNLNQAKLPFKFRDE 274
            .:.||....|..|    .::.|:::..:.|.|       |..:|..|.|....:...:|.|:.| 
Human  1206 ILSTEYRHAHERGDVTITKKDESEAQKNHLAPTNSDSTLQNGVFYSCAREGEPDSPDIPEKWMD- 1269

  Fly   275 ADHYLLQLEVYRHLDTSLIDVDVQTTYTRVTVKKK----------IFQIAYSEEVKPDESTVQRS 329
                  .:..:..|..|....:::..:..:.|.:|          ..:|.:.|.|          
Human  1270 ------SVSSHSPLSKSATCENMEGRHQEILVCQKREDSKASSIPTIRIPFKEVV---------- 1318

  Fly   330 QITGHLVVNLKKLKVNELLIA 350
             :|..|:.|.:.::.:|.::|
Human  1319 -MTNSLLRNHQNIEPSEKIMA 1338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 52/197 (26%)
leucine-rich repeat 23..45 CDD:275378 6/21 (29%)
LRR_4 46..86 CDD:289563 16/50 (32%)
leucine-rich repeat 46..67 CDD:275378 9/20 (45%)
leucine-rich repeat 68..89 CDD:275378 7/44 (16%)
leucine-rich repeat 90..114 CDD:275378 7/24 (29%)
LRRIQ1XP_011537119.1 DUF4515 164..343 CDD:291649
LRR_4 818..856 CDD:289563
leucine-rich repeat 820..841 CDD:275380
leucine-rich repeat 842..862 CDD:275380
leucine-rich repeat 863..884 CDD:275380
leucine-rich repeat 885..920 CDD:275380
leucine-rich repeat 921..970 CDD:275380
LRR_RI <963..1095 CDD:238064 32/124 (26%)
leucine-rich repeat 971..992 CDD:275380 3/17 (18%)
leucine-rich repeat 993..1014 CDD:275380 7/24 (29%)
leucine-rich repeat 1015..1036 CDD:275380 9/20 (45%)
LRR_8 1037..1091 CDD:290566 12/53 (23%)
leucine-rich repeat 1037..1060 CDD:275380 6/22 (27%)
leucine-rich repeat 1083..1108 CDD:275380 7/24 (29%)
leucine-rich repeat 1109..1135 CDD:275380 11/42 (26%)
IQ 1338..1354 CDD:197470 1/1 (100%)
IQ 1394..1415 CDD:197470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.