DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and CEP97

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_078824.2 Gene:CEP97 / 79598 HGNCID:26244 Length:865 Species:Homo sapiens


Alignment Length:419 Identity:92/419 - (21%)
Similarity:151/419 - (36%) Gaps:145/419 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVENLEGCESLSKLDL--------------- 95
            |::|.|..|.|..:|.|.:|..||:||:|.||::.:|.:..|.:|..|||               
Human    82 LRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLV 146

  Fly    96 ---TL----------------------------NFIRELTSVESLCGNYNLRELVLIGNPCV--- 126
               ||                            |.||:|..:..|.....|.:|.::.||||   
Human   147 SLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMAT 211

  Fly   127 -DYP--HYRDYVVATLPQLNSLDCVEITPSERLRA--LRELSKNRSIIVQKQVEQDIERDEQRIR 186
             ..|  .||.|:|:....|..||...|:..|.|:|  |....|.|:.           |..|.|:
Human   212 PSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAY-----------RPGQHIQ 265

  Fly   187 VAKQQSALAEHC-----AGIEDEEERIKAFWQAKSEHCPEIRTEIARQHRLGRERHETKSPLDPL 246
            :.:.   ||..|     .|::..|:       ||.|.... :....::..:.:.::|..|||.|:
Human   266 LVQY---LATVCPLTSTLGLQTAED-------AKLEKILS-KQRFHQRQLMNQSQNEELSPLVPV 319

  Fly   247 KPQRNLFAPCGRPY---NLNQAKLPFKFRDEADHYLLQLEVYRHL---DTSLIDV------DVQT 299
            :.:.:|......|.   .::|...|          ::|:..:..:   |..|..|      .|.|
Human   320 ETRASLIPEHSSPVQDCQISQESEP----------VIQVNSWVGINSNDDQLFAVKNNFPASVHT 374

  Fly   300 T-YTRVTVKKKIFQIAYSEEVKPDESTVQRSQITGHLVVNLKKLKVNELLIAKKS---PTKSPAA 360
            | |:|..:        :.|:::.||.                  |:|..|::.:|   |..|..:
Human   375 TRYSRNDL--------HLEDIQTDED------------------KLNCSLLSSESTFMPVASGLS 413

  Fly   361 PFDAG------------KKDGKPEEAFHG 377
            |....            :.||..:|:..|
Human   414 PLSPTVELRLQGINLGLEDDGVADESVKG 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 49/181 (27%)
leucine-rich repeat 23..45 CDD:275378
LRR_4 46..86 CDD:289563 16/39 (41%)
leucine-rich repeat 46..67 CDD:275378 8/20 (40%)
leucine-rich repeat 68..89 CDD:275378 9/20 (45%)
leucine-rich repeat 90..114 CDD:275378 11/69 (16%)
CEP97NP_078824.2 leucine-rich repeat 17..37 CDD:275380
LRR 1 37..58
leucine-rich repeat 38..59 CDD:275380
LRR 2 59..80
leucine-rich repeat 60..81 CDD:275380
LRR_8 63..114 CDD:290566 14/31 (45%)
LRR_RI <78..200 CDD:238064 29/117 (25%)
LRR 3 81..102 7/19 (37%)
leucine-rich repeat 82..103 CDD:275380 8/20 (40%)
LRR_8 103..156 CDD:290566 15/52 (29%)
LRR 4 103..124 8/20 (40%)
leucine-rich repeat 104..125 CDD:275380 9/20 (45%)
LRR_4 124..161 CDD:289563 6/36 (17%)
LRR 5 125..146 4/20 (20%)
leucine-rich repeat 126..147 CDD:275380 4/20 (20%)
LRR_8 147..206 CDD:290566 9/58 (16%)
LRR 6 147..168 2/20 (10%)
leucine-rich repeat 148..171 CDD:275380 2/22 (9%)
LRR 7 171..192 4/20 (20%)
leucine-rich repeat 172..196 CDD:275380 5/23 (22%)
LRR 8 196..205 2/8 (25%)
CCP110-binding 300..750 32/179 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 506..529
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..769
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.